KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3891Help
Entry
y3891             CDS       T00092                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase (aerobic)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00564  Glycerophospholipid metabolism
ypk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    y3891 (glpD)
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     y3891 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AAM87436
UniProt: Q8CWG4
LinkDB All DBs
Position
complement(4346370..4347968)
Genome map
AA seq 532 aa AA seqDB search
MAYLLVFDYNRERKRTLKRCFEHSEEGNMETKDLIVIGGGINGAGIAADAAGRGLSVLLL
EAQDLACATSSASSKLIHGGLRYLEHYEFRLVSEALAEREVLLKLAPHIAFPMRFRLPHQ
PHLRPAWMIRTGLFLYDHLGKRTSLPASKGLRFGPESVLKPELVRGFEYSDCWVDDARLV
VLNAQEVVKHGGEVRTRTKVTRAWREQGLWMVEALDVNTGKTFTWRAKGLVNATGPWVKQ
FFDDGLKLKSPYGIRLIKGSHIVVPRVHNQPQAYILQNEDHRIVFVIPWLDDYSIIGTTD
VEYHGDPKEVKIDDQEMTYLLKVYNDHFKKQLGRDDIVWTYSGVRPLCDDESDSPQAVTR
DYTLDVADEAGQAPLLSVFGGKLTTYRKLAEHALEKLSAYYPNVGPAWTKTGALPGGDIG
GSRDSYTVQLRHRYNWLPEGLARRYTRTYGSHSELILANATRLESLGEHFGHGLYEAELR
YLVENEWVVELDDAIWRRTKLGMALSDEEKQRVAQWLADAHTEKQQALPLVS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
ttggcttatttgttggtttttgattacaatcgtgagcgaaaacgaacattaaagcgctgt
ttcgaacattcagaggaaggtaacatggaaaccaaagacttgatcgtgatcggtggcggt
attaacggtgccggtatcgctgcggacgctgctgggcgtggcctgtcggtactgctgctg
gaagcgcaagacttggcctgtgctacgtcttccgccagttccaaacttatccatggtggc
ttacgctatctggaacattatgaattccgcttggtaagtgaagccttggccgagcgtgaa
gtgttactgaaactggcaccgcatatcgcattccctatgcgcttccgcctaccccaccag
cctcatctacgcccggcatggatgatccgcaccggcttgttcttgtatgaccatttgggc
aaacgtaccagcctgcctgccagtaaagggctgcgttttgggccggaatctgtgttaaag
cccgagttggtgcgcggtttcgaatattctgactgttgggtggatgatgcccgcctggtg
gtgctgaatgcgcaggaagtggttaaacacggcggtgaagtccgaacccgtaccaaagtg
acccgcgcatggcgtgaacaaggcctatggatggttgaagcccttgatgtcaataccggc
aaaaccttcacctggcgggctaaaggcttagtgaatgccactggcccttgggttaaacag
ttcttcgacgatggcctaaagctcaaatcaccttatggcatccgcctaattaaaggcagc
cacattgtggtgcctcgggttcataaccaaccgcaggcgtatattctgcaaaatgaagat
caccgtatcgttttcgttatcccttggttagatgactattccatcatcggtactaccgac
gtggaataccacggcgatccaaaagaggtgaaaattgacgatcaggaaatgacttatctg
ctgaaagtctataacgaccactttaaaaaacagttgggtcgtgacgatatcgtctggacc
tactctggtgtgcgcccgctatgcgacgatgaatcagattcaccgcaagccgttacccgc
gattacacgctagatgtggccgatgaagcgggtcaggcaccactgctgtcggtcttcggc
ggtaagctcaccacgtaccgtaaattggcagaacatgcgctggaaaaactgtcagcgtac
tacccgaatgtcggcccagcgtggactaaaaccggtgccttgcccggtggggatatcggc
ggtagtcgtgatagctataccgtgcaattacgccaccgctataactggttgccggaaggg
ttagcccgccgctatacccgtacctatggtagccacagcgagctaattttagccaacgcg
acccgtcttgaaagcctaggtgagcactttggtcacggcttgtatgaggctgaattgcgc
tatttggttgagaacgagtgggtcgttgagctggatgatgctatctggcgtcgtaccaaa
ttaggcatggccctcagcgatgaagagaaacagcgggtagcccagtggctggctgatgcg
cacactgaaaaacaacaggcgctgccgctggtttcttaa

DBGET integrated database retrieval system