KEGG   Yersinia pestis El Dorado: CH46_1714Help
Entry
CH46_1714         CDS       T03719                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypl  Yersinia pestis El Dorado
Brite
Enzymes [BR:ypl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH46_1714 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJJ13874
UniProt: A0A384KRV4 A0A380PGN9
LinkDB All DBs
Position
1898495..1899100
Genome map
AA seq 201 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKASMNDKASMNDMASMNGKASMTVKINESLPQG
NGKALGTVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHL
DPNKTGVHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDN
YSDHPMPLGGGGARMACGVIE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggccagcatgaatgataaggccagcatgaatgatatg
gccagcatgaatggtaaggctagcatgactgtgaaaatcaacgaatcattgccacaaggt
aatgggaaagcgcttggcaccgtgacggtgactgaaaccgcttatggcttactgtttacg
ccacatctcactgggctggctccgggaattcacggtttccatctgcatgaaaaacccagt
tgtgctccggggatgaaagatggcaaggcagtgccagcattggcagccggggggcatctt
gacccaaataagaccggggtacaccttggtccttacaacgataaagggcatctgggggat
ctgccgggattggtggttaatgcagatggcaccgccacctatcccgtattggctccgcgc
ctgaaatcgttgtcagaggtgaaacagcatgcgttaatgatccatgctggcggtgataat
tactctgatcatccaatgcctttaggcggtggtggcgcacggatggcatgtggagtcatt
gagtaa

DBGET integrated database retrieval system