KEGG   Yersinia pestis El Dorado: CH46_3671Help
Entry
CH46_3671         CDS       T03719                                 

Definition
(GenBank) fabA-like domain protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ypl  Yersinia pestis El Dorado
Pathway
ypl00061  Fatty acid biosynthesis
ypl00780  Biotin metabolism
ypl01100  Metabolic pathways
ypl01212  Fatty acid metabolism
Module
ypl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ypl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CH46_3671
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CH46_3671
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ypl01004]
    CH46_3671
Enzymes [BR:ypl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CH46_3671
Lipid biosynthesis proteins [BR:ypl01004]
 Fatty acid synthase
  Component type
   CH46_3671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA NKWYS
Motif
Other DBs
NCBI-ProteinID: AJJ14246
UniProt: Q8D063
LinkDB All DBs
Position
complement(4021636..4022160)
Genome map
AA seq 174 aa AA seqDB search
MKNTELNFLKTNFLFNQDITNELNTSFGQDIIKKMIPHREPFLMVDNVELINIECRLIKA
IRRVDEKDPVFGGHFPNDPIYPGVLQQESMFQTALILMYFLLNETAIPPAEENIIHAVGT
RVYDVFHLSAVRPGELMTIRCCITEYDTFLATAIVQITVNDQIVTVGKGEFHVF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatactgaattaaattttttaaaaacgaattttttatttaaccaagatattact
aatgaattgaatacatcatttggacaagatatcattaaaaaaatgataccgcatcgtgaa
ccatttttaatggtcgacaacgtagagctgatcaatattgaatgcaggttaataaaagca
ataagaagagttgacgaaaaagacccggtatttggtggtcatttccccaatgaccctata
tatccaggtgtattgcaacaagaaagtatgtttcaaaccgcgcttattttaatgtatttt
ctgctaaatgaaacggctattccgccagcagaggagaatatcatccacgcagtgggaaca
cgagtatacgatgtctttcacttgtccgcagtacgcccaggagaattaatgacaatccgt
tgttgtattacagaatacgacacatttcttgccaccgccattgttcaaatcacggttaac
gatcagatcgtaaccgtcggaaaaggagagtttcatgtcttctga

DBGET integrated database retrieval system