KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0664Help
Entry
YP_0664           CDS       T00165                                 

Gene name
emrA
Definition
(GenBank) multidrug resistance protein A
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypm02000]
    YP_0664 (emrA)
Transporters [BR:ypm02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   YP_0664 (emrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_D23 HlyD_3 Biotin_lipoyl_2 Orf78 Biotin_lipoyl DUF2157 MacB_PCD Gemini_mov CCSMST1 DUF4398
Motif
Other DBs
NCBI-ProteinID: AAS60931
UniProt: Q8D177
LinkDB All DBs
Position
complement(718810..719994)
Genome map
AA seq 394 aa AA seqDB search
MENTMSESAGAQAPQRPQNKKQQRKRVLLLLTAIFIMIGVAYLIYWFLVLRHHQETDNAY
ISGNQVQIMSQVPGSVVSVHFENTDFVKSGDVLVTLDPTDAEQAFEQAKTALANSVRQTH
QLIINSKQYQANIALKKTELSQAQNDLKRRVVLGAAAVIGREELQHARDAVEAAQASLDM
AVQQYNANQALVLNTPLEKQPAIEQAAAKMRDAWLTLQRTKVVSPISGYVSRRSVQVGAE
ISSGTPLMAVVPADQLWIDANFKETQLANMRIGQPATIVTDFYGDDVVYQGKVVGLDMGT
GSAFSLLPAQNATGNWIKVVQRLPVRIALDEKQLKEHPLRIGLSSLVKVDTANTDGHVLA
QNVRKEPAFMTNALSLDFAPVNQIISDIIHANAD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtggagaacaccatgagtgaaagtgcgggagcccaagccccacaacgaccgcagaataaa
aaacagcaacgtaaacgtgtactgctgttgctgacggccatttttattatgatcggggtg
gcttaccttatttattggttcctggtgctacgccatcaccaagagactgataatgcctat
atttcaggcaaccaagtccagattatgtctcaagttcccggcagtgtggtcagtgttcat
ttcgaaaatacggacttcgtcaaaagtggcgatgtgctggtgacactcgaccccaccgat
gcagaacaggcatttgagcaagcgaaaactgccttggcaaatagcgtgcgccaaacccac
cagctcattattaacagtaaacagtatcaagcgaatattgcgctgaaaaaaacggaattg
agccaggcacaaaatgacctgaagcgtcgggtggtcctgggggctgccgcagtcatcggc
cgtgaagaattgcaacacgcacgtgatgctgttgaggcggcacaagcgtcgttggatatg
gcagtgcagcaatataacgccaatcaggcgttggtcctcaatacgccattggagaaacaa
ccggcgattgagcaggcggccgctaaaatgcgtgatgcctggctcaccctgcagcgcacc
aaagtagttagcccaattagcggctatgtctcgcgtcgcagtgtacaagtgggtgctgaa
atcagtagtggtacgccgttaatggcggtggttccggcagatcaactgtggatcgacgct
aacttcaaagaaactcagttggcgaacatgcgaattggccaaccggcgactatcgtgacc
gatttttacggtgatgatgtggtttatcaagggaaagtggtcggtttagatatgggaacc
ggcagtgccttctcgctactacccgcgcaaaatgccaccggtaactggatcaaagtggtc
caacgcctgccagtacgaattgcattggatgagaaacaactgaaggagcatccgttacgt
attggtctgtcatcgctggttaaagtcgacaccgccaataccgatggacacgttttggca
caaaacgtgcgtaaagaacccgcgttcatgaccaatgcattgtcattagatttcgcgcca
gttaatcaaataattagcgatattattcatgcaaacgccgattaa

DBGET integrated database retrieval system