KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0875Help
Entry
YP_0875           CDS       T00165                                 

Gene name
fabA
Definition
(GenBank) beta-hydroxydecanoyl thioester dehydrase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00061  Fatty acid biosynthesis
ypm01100  Metabolic pathways
ypm01212  Fatty acid metabolism
Module
ypm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YP_0875 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ypm01004]
    YP_0875 (fabA)
Enzymes [BR:ypm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     YP_0875 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     YP_0875 (fabA)
Lipid biosynthesis proteins [BR:ypm01004]
 Fatty acid synthase
  Component type
   YP_0875 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AAS61132
UniProt: Q8ZG80
LinkDB All DBs
Structure
PDB: 

Position
complement(939561..940187)
Genome map
AA seq 208 aa AA seqDB search
MAITLAKLVQPGLIGLAQRTAVRYSAHFTNIRLTENMVDKRESYTKEDLEASGRGELFGA
GGPPLPAGNMLMMDRIVKMIEDGGSHNKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGL
DAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPDAKKVTYRINFKRVIMRKLIMGVA
DGEVLVDGKVIYTATDLKVGLFKDTNAF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccattacgctggctaaactggttcaaccagggctaatcggacttgctcagcgtaca
gctgtacgctattctgcgcacttcactaacataaggcttactgagaacatggtagataaa
cgcgaatcctatacaaaagaagaccttgaagcatccggccgtggcgagttgtttggcgct
ggtgggccacccttacccgcaggcaatatgttaatgatggaccgtattgtcaaaatgata
gaagacggtggcagccataataaaggttatgtggaagcggaactggatatcaatccagat
ctatggttcttcggttgccattttatcggtgatcccgtcatgcctggctgtctgggcctt
gatgccatgtggcagttggttggtttctatctcggctggctcggtggcgaaggcaaaggc
cgcgcactgggtgttggtgaagttaaattcaccggccaggtgctgccagatgcgaaaaaa
gtgacataccgtattaattttaaacgcgtgattatgcgtaaattaattatgggcgttgcg
gatggtgaagtcttggttgatggcaaagtgatttacactgccactgatttgaaagtaggt
ctgtttaaagacaccaacgctttctaa

DBGET integrated database retrieval system