KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2034Help
Entry
YP_2034           CDS       T00165                                 

Gene name
rnb
Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypm03016]
    YP_2034 (rnb)
Enzymes [BR:ypm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     YP_2034 (rnb)
Transfer RNA biogenesis [BR:ypm03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    YP_2034 (rnb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2
Motif
Other DBs
NCBI-ProteinID: AAS62250
UniProt: Q8ZED8
LinkDB All DBs
Position
complement(2256481..2258415)
Genome map
AA seq 644 aa AA seqDB search
MFQDNPLLAQLKQQLHTQTPRVEGVVKGTEKGFGFLEVDGQKSYFIPPPQMKKVMHGDRI
IATLHTDKDREIAEPETLVEPFLSRFVGRVQRKDDRLSIVPDHPLLRDAIQCRPVRELTH
SFQNGDWAVAEMCRHPLKGDRAFQADLTAFITNGEDHFVPWWVTLARHNLEREAPAMVES
ALNDAELEREDLTALNFVTIDSASTEDMDDALFVQDNGDGSWLLTIAIADPTAYVVENSE
LDLTARKRAFTNYLPGFNIPMLPRDLSDNLCSLRPNERRPVLVCRVTITEEGTLSNDIRF
SAAWVESKAKLVYDDVSDWLEGNNRWQPQDTAIAEQITLLKRICDARSNWRQQHALVFKD
RPDYRFLLGEKGEVLDIIVEHRRIANRIVEECMIAANVCAALALREHLGFGIYNVHTGFD
PALVEQAASVLKANGVGADPQALLTLPGFCELRRHLDALPTQFLDSRIRRFQTFAEISTV
PGPHFGLGLEAYATWTSPIRKYGDMVNHRLLKAMITGQQAEKPQEEITVQLAERRRLNRM
AERDVGDWLYARYLQPQAGTDTRFTAEIIDITRGGLRVRLLDNGAVAFIPAPFIHAVRDE
VVCSQETGTVQIKGETVYSQSDKIEVRIAEVRMETRNVIARPVA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaagataacccgctgctggcgcagctaaaacagcaacttcacactcagacccca
cgcgttgaaggcgtcgttaaaggtactgagaaaggctttggctttcttgaggtagatggg
cagaaaagttactttattccgcctccgcagatgaagaaggtcatgcacggcgatcgcatt
attgccaccctgcatacggataaggatcgtgaaattgctgaacctgaaacattggttgag
ccatttttatcccgctttgttggccgggtgcaacgaaaagatgatcgtctgtctatcgtg
cccgaccaccctttattacgtgatgctattcaatgccgcccagtacgtgaactgacgcat
agcttccaaaacggtgattgggcagtggctgagatgtgccgccacccattaaaaggcgac
cgcgcctttcaggctgacctaaccgcgtttattaccaatggtgaagaccacttcgttcct
tggtgggtaacactggctcgccataaccttgagcgtgaagcccctgctatggtcgaatcg
gccttaaatgacgccgagcttgagcgtgaagacttaaccgcacttaattttgtcactatc
gacagcgccagcactgaagacatggatgatgcgctgtttgtccaagacaatggcgacggt
tcatggttattgaccattgccattgcagacccaacagcttacgtcgtcgaaaacagtgaa
ttggatttaaccgcccgtaagcgtgcttttaccaattatctgccgggttttaacatcccg
atgcttccgcgtgatttgtccgacaacctctgttcactgcgcccaaatgaacgtcgccca
gtattggtttgccgtgtgacgatcacagaagaagggacgctaagtaacgatattcgtttc
tccgctgcttgggttgaatcaaaagccaaactggtttacgacgatgtctctgactggttg
gaaggaaataatcgctggcagccacaagataccgctattgcagagcagattacgttactg
aaacgtatctgtgacgcccgtagcaactggcgtcaacaacatgcgctggtctttaaagac
cgcccagactatcgcttcctgttgggtgaaaaaggcgaagtgctggatatcattgttgag
catcgtcgtatcgccaaccgcattgtagaagagtgtatgattgcggcgaacgtctgtgcg
gcattggcgttacgggaacacctcggttttggtatttataacgtgcataccggttttgac
ccggcattagtcgaacaagcggctagcgtattgaaagccaatggtgttggtgccgatcct
caagccctgctgacgttacccggtttctgtgagttacgccgtcaccttgatgccctgcca
acacagttcctcgacagccgtattcgccgtttccagacatttgctgaaattagtactgtc
cccggtccgcattttggcttggggcttgaagcctatgccacctggacatctccaatccgt
aaatacggcgacatggtcaatcatcgcctgctgaaagcgatgattactggtcaacaagca
gaaaaaccacaagaagagatcacggtccaattggctgaacgtcgccgcctgaatcgcatg
gctgaacgtgatgtcggtgattggttgtatgcccgttatctgcaaccacaagcaggaact
gacactcgtttcacggcagagattattgatatcacccgcggtggcttgcgtgtgcgttta
ctggataacggtgccgttgcctttattcctgcgccgtttattcacgcggtgcgtgatgaa
gtggtctgcagccaggaaaccggtactgtgcagatcaaaggcgaaacagtttatagccaa
agtgacaaaatcgaggtacgtattgcggaagttcgcatggaaacccgtaatgtcattgct
cgcccagtagcttaa

DBGET integrated database retrieval system