KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2153Help
Entry
YP_2153           CDS       T00165                                 

Gene name
gst2
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00480  Glutathione metabolism
ypm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YP_2153 (gst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypm02000]
    YP_2153 (gst2)
Enzymes [BR:ypm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YP_2153 (gst2)
Transporters [BR:ypm02000]
 Other transporters
  Pores ion channels [TC:1]
   YP_2153 (gst2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AAS62361
UniProt: Q8D0L3
LinkDB All DBs
Structure
PDB: 

Position
2396651..2397259
Genome map
AA seq 202 aa AA seqDB search
MMKLFYKPGACSLSPHIVLREAGLDFSIERVDLVTKKTETGADYLSINPKGQVPALVLDD
GSLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPNTPD
EYKTIVRERLDKQFSYVDSVLAEHDYLLGKKFSVADAYLFTVSRWANALNLQIKERSHLD
QYMARVAERPAVKAALAAEDIK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaactgttctataaaccgggtgcttgttctctgtccccccatattgtgttgcgg
gaagcaggactagatttcagcattgaacgtgttgatttagtgacaaaaaagactgaaacg
ggtgcagactatttaagcatcaaccccaaaggacaagtaccggctttagtgctggatgac
ggtagcctactgactgaaggggtagctattgtgcaatatttggcagataaagtcccagac
cgccacttgattgccccatcagggacgctctcgcgctatcatgccattgagtggctgaat
tttatcgcgactgaactacataaaggttttagcccactatttaacccaaatacaccggat
gagtataagacgattgtccgcgagcggctggataagcaattcagctacgttgatagcgta
ttagcagagcatgattatctactaggtaaaaaattcagtgtggcagatgcctacttattt
accgttagccgttgggctaatgcgttaaatcttcaaatcaaagaacgcagccatttggat
caatatatggcgcgggtcgctgaacgccctgcggtaaaagcagctttagccgccgaagat
atcaagtaa

DBGET integrated database retrieval system