KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3299Help
Entry
YP_3299           CDS       T00165                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00564  Glycerophospholipid metabolism
ypm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    YP_3299 (glpD)
Enzymes [BR:ypm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YP_3299 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AAS63464
UniProt: Q8CWG4
LinkDB All DBs
Position
3679608..3681206
Genome map
AA seq 532 aa AA seqDB search
MAYLLVFDYNRERKRTLKRCFEHSEEGNMETKDLIVIGGGINGAGIAADAAGRGLSVLLL
EAQDLACATSSASSKLIHGGLRYLEHYEFRLVSEALAEREVLLKLAPHIAFPMRFRLPHQ
PHLRPAWMIRTGLFLYDHLGKRTSLPASKGLRFGPESVLKPELVRGFEYSDCWVDDARLV
VLNAQEVVKHGGEVRTRTKVTRAWREQGLWMVEALDVNTGKTFTWRAKGLVNATGPWVKQ
FFDDGLKLKSPYGIRLIKGSHIVVPRVHNQPQAYILQNEDHRIVFVIPWLDDYSIIGTTD
VEYHGDPKEVKIDDQEMTYLLKVYNDHFKKQLGRDDIVWTYSGVRPLCDDESDSPQAVTR
DYTLDVADEAGQAPLLSVFGGKLTTYRKLAEHALEKLSAYYPNVGPAWTKTGALPGGDIG
GSRDSYTVQLRHRYNWLPEGLARRYTRTYGSHSELILANATRLESLGEHFGHGLYEAELR
YLVENEWVVELDDAIWRRTKLGMALSDEEKQRVAQWLADAHTEKQQALPLVS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
ttggcttatttgttggtttttgattacaatcgtgagcgaaaacgaacattaaagcgctgt
ttcgaacattcagaggaaggtaacatggaaaccaaagacttgatcgtgatcggtggcggt
attaacggtgccggtatcgctgcggacgctgctgggcgtggcctgtcggtactgctgctg
gaagcgcaagacttggcctgtgctacgtcttccgccagttccaaacttatccatggtggc
ttacgctatctggaacattatgaattccgcttggtaagtgaagccttggccgagcgtgaa
gtgttactgaaactggcaccgcatatcgcattccctatgcgcttccgcctaccccaccag
cctcatctacgcccggcatggatgatccgcaccggcttgttcttgtatgaccatttgggc
aaacgtaccagcctgcctgccagtaaagggctgcgttttgggccggaatctgtgttaaag
cccgagttggtgcgcggtttcgaatattctgactgttgggtggatgatgcccgcctggtg
gtgctgaatgcgcaggaagtggttaaacacggcggtgaagtccgaacccgtaccaaagtg
acccgcgcatggcgtgaacaaggcctatggatggttgaagcccttgatgtcaataccggc
aaaaccttcacctggcgggctaaaggcttagtgaatgccactggcccttgggttaaacag
ttcttcgacgatggcctaaagctcaaatcaccttatggcatccgcctaattaaaggcagc
cacattgtggtgcctcgggttcataaccaaccgcaggcgtatattctgcaaaatgaagat
caccgtatcgttttcgttatcccttggttagatgactattccatcatcggtactaccgac
gtggaataccacggcgatccaaaagaggtgaaaattgacgatcaggaaatgacttatctg
ctgaaagtctataacgaccactttaaaaaacagttgggtcgtgacgatatcgtctggacc
tactctggtgtgcgcccgctatgcgacgatgaatcagattcaccgcaagccgttacccgc
gattacacgctagatgtggccgatgaagcgggtcaggcaccactgctgtcggtcttcggc
ggtaagctcaccacgtaccgtaaattggcagaacatgcgctggaaaaactgtcagcgtac
tacccgaatgtcggcccagcgtggactaaaaccggtgccttgcccggtggggatatcggc
ggtagtcgtgatagctataccgtgcaattacgccaccgctataactggttgccggaaggg
ttagcccgccgctatacccgtacctatggtagccacagcgagctaattttagccaacgcg
acccgtcttgaaagcctaggtgagcactttggtcacggcttgtatgaggctgaattgcgc
tatttggttgagaacgagtgggtcgttgagctggatgatgctatctggcgtcgtaccaaa
ttaggcatggccctcagcgatgaagagaaacagcgggtagcccagtggctggctgatgcg
cacactgaaaaacaacaggcgctgccgctggtttcttaa

DBGET integrated database retrieval system