KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0813Help
Entry
YPN_0813          CDS       T00370                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
ypn01130  Biosynthesis of antibiotics
ypn01230  Biosynthesis of amino acids
ypn02024  Quorum sensing
Module
ypn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YPN_0813
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YPN_0813
Enzymes [BR:ypn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     YPN_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ABG17145
UniProt: A0A0H2YER3
LinkDB All DBs
Position
942307..943383
Genome map
AA seq 358 aa AA seqDB search
MIMQKDSLNNVHISAEQILITPEELKNQFPLSENDQYSIERARKTIADIIQGRDPRLLVV
CGPCSIHDVDAALDYARRLKKLSVELDDSLYIVMRVYFEKPRTTVGWKGLINDPAMDGSF
DVEAGLHIARRLLLDLVGMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMAS
GLSMPVGFKNGTDGSLGTAINAMRAAAMPHRFMGINQSGQVCLLQTQGNPHGHVILRGGK
TPNYSAQDVAQCEKQMQDAGLIPSLMIDCSHGNSNKDYRRQVAVAESVVEQIKAGNRSIT
GVMLESHIHEGNQSSEQPRADMRYGVSVTDACINWESTETLLRGMRQELLAALTARTA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgcaaaaagactcgctcaataacgtccatatcagtgccgaacaaatcctgata
accccggaagaactgaaaaatcagtttccactgagcgaaaatgatcagtattcgatagag
cgcgcacgtaaaaccattgctgacattattcaggggcgagatccgcgtctgttggtcgtt
tgtgggccctgttcaattcatgatgtggatgcggcactggattacgcgcgtcgtttgaaa
aaactctctgtggaattggatgacagcttatatatcgttatgcgtgtctattttgagaag
ccaagaactaccgtgggttggaaaggcctgatcaatgaccctgcaatggatggttcattt
gatgtagaggcaggtttacacattgcccgtcgtttattgctggatttagtgggcatgggg
ttgccgttagcgactgaagctctggatcctaatagcccacaatatttaggtgacctgttc
agttggtcggccattggtgcccgtacaacggagtcacagacccaccgtgaaatggcatca
ggcttgtctatgccggttggatttaaaaatggcactgacggtagcctaggcacggcaatc
aatgcaatgcgcgccgctgccatgccacatcgctttatggggatcaatcagtcgggccag
gtctgcctgttacaaactcagggtaacccacacggccatgtcattctacggggaggtaaa
acaccaaactacagtgcacaagatgtcgctcagtgtgaaaaacagatgcaggatgcggga
ctcatcccatccttaatgatagattgcagtcacggtaattcaaataaagactaccgccgt
caggttgcggtggctgaatctgtggttgaacagatcaaggcgggcaatcgttcaattaca
ggtgtgatgctggaaagccacatccacgaaggaaatcagtcatctgaacagccacgtgct
gatatgcgctacggtgtttctgtgactgacgcctgtattaactgggaaagcactgaaacc
ctgttacgtggtatgcgccaagaattgcttgcagcactgacggcacggactgcatga

DBGET integrated database retrieval system