KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2690Help
Entry
YPN_2690          CDS       T00370                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase family protein
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00260  Glycine, serine and threonine metabolism
ypn00270  Cysteine and methionine metabolism
ypn00680  Methane metabolism
ypn01100  Metabolic pathways
ypn01120  Microbial metabolism in diverse environments
ypn01130  Biosynthesis of antibiotics
ypn01200  Carbon metabolism
ypn01230  Biosynthesis of amino acids
Module
ypn_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    YPN_2690
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPN_2690
   00270 Cysteine and methionine metabolism
    YPN_2690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypn04147]
    YPN_2690
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     YPN_2690
    1.1.1.399  2-oxoglutarate reductase
     YPN_2690
Exosome [BR:ypn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YPN_2690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN
Motif
Other DBs
NCBI-ProteinID: ABG19018
UniProt: A0A0H2YJ89
LinkDB All DBs
Position
3036793..3037743
Genome map
AA seq 316 aa AA seqDB search
MRLVVTDQAFGNTVYEQAAANAVGADFAAYQCRTEDETRDAVQGADVVLNNFAPMTERVM
AAMPPGAVIVRYGVGVDNIDLSAARKRGMRICNVPDYGIEEVADHAAAMTLALARKLGRY
EAGIRSGRWEIDQMVDGVRSLRDTTVGLIGLGRIARAYATRMAVFGCRIIGFDPYVTETE
ARSAGIEPLPQDKVIASAHILSLHVPLTPETRDLIDTTAIARMPEGAILINCARGGLVNE
VALIEALTRGHLSGAGLDVFEQEPLPADSALRKAPHLLLSPHAAFFSDASVKKLQQLASE
EALRGLRGEPLRCPLT
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagattggtcgtcaccgatcaggctttcggcaataccgtttatgaacaagcagcggcc
aacgcggttggtgccgatttcgccgcctatcaatgccgcactgaagatgaaacgcgggat
gccgtgcagggcgcagatgtcgtgttgaacaacttcgccccgatgaccgagcgggtgatg
gcggccatgccccccggcgcggtgatcgtgcggtacggcgtcggtgtcgataacatcgat
ctctctgcggccagaaaacgggggatgcgtatttgtaatgtgccggattacggcattgaa
gaggttgccgaccacgccgccgccatgacattggcgttagcacgcaaactggggcgctac
gaggcagggatccgtagcggcaggtgggaaattgaccagatggtcgatggtgtgcggtca
ttgcgtgacaccacggtagggctgatcggccttgggcgcatcgcgcgcgcctatgcaaca
cgaatggcggttttcggttgccgcatcatcggcttcgacccgtatgtcactgagacagaa
gcccgttcggcggggatcgagccgctgccacaggataaggtcatcgcctcggcccacatc
ctgtcgctacatgttccgctaacgcctgaaactcgcgacctgatcgataccaccgctatc
gcacgtatgcctgagggcgcgatcctgatcaactgcgcccgtggcgggctggtgaatgag
gtggccttaatcgaggcattgacccgtggccacctatcgggggccggactcgacgtcttc
gagcaagaacccctcccggctgattcggccttgcgtaaagcgccccatctccttctctcg
ccccatgccgcttttttctcggatgcgtcggtcaaaaaactgcaacaactggcttctgaa
gaggccctacggggactgcgcggtgagccactgcgctgcccactgacttaa

DBGET integrated database retrieval system