KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2710Help
Entry
YPN_2710          CDS       T00370                                 

Definition
(GenBank) ribosomal small subunit pseudouridine synthase A
  KO
K06183  16S rRNA pseudouridine516 synthase [EC:5.4.99.19]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ypn03009]
    YPN_2710
Enzymes [BR:ypn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.19  16S rRNA pseudouridine516 synthase
     YPN_2710
Ribosome biogenesis [BR:ypn03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    YPN_2710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ABG19038
UniProt: A0A0H2YKE1
LinkDB All DBs
Position
complement(3059506..3060213)
Genome map
AA seq 235 aa AA seqDB search
MRLDKFLSQQLGVSRALVARELRAKRVTIDGEVVKSGAIKLTPEQDVRFDGNPLQQMVGP
RYFMLNKPQGYVCSTEDPDHPTVLYFLDEPVAYKLHAAGRLDIDTTGLVLMTDDGQWSHR
VTSPRHHCEKTYLVTLEHPLSDDTAQQFADGVQLYNEKSLTKPAQLDVIEPQRVRLTISE
GRYHQVKRMFAAVGNRVIELHRERIGDITLDDDLAPGEYRPLTTEEIASVGAPHL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgattggacaagtttttatctcagcaattaggggtcagccgggcgttggtagcgcgt
gaactgcgggcaaagcgtgtgactattgatggcgaggtggtcaaaagtggtgccatcaag
ctgacaccggaacaagacgtgcgatttgatggcaatccgttacagcagatggttggcccc
cgttattttatgttgaacaaaccgcagggctatgtgtgttcgacggaagatcccgatcat
ccaacggtgttgtatttccttgatgagccagtggcttacaaactccatgccgctgggcgg
ttggatatcgatactaccgggttggtcttgatgactgacgatgggcagtggtcacatcgc
gtcacttcgccacgtcatcattgtgaaaagacctatttggtgacgttggaacatccgcta
tccgatgacaccgcacagcaatttgctgacggtgtccaactgtacaatgaaaaatccctg
accaaaccggctcaactggacgttatcgagccgcaacgggtgcgtttgaccatcagcgaa
gggcgttatcatcaggtgaagcggatgtttgctgctgtggggaaccgagtgattgagtta
catcgtgaacgcattggtgatatcacgcttgatgatgatttagcccctggtgagtaccgg
ccgctgacgacagaagagatcgccagcgtgggtgccccacacttgtaa

DBGET integrated database retrieval system