KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3724Help
Entry
YPN_3724          CDS       T00370                                 

Definition
(GenBank) alpha-amylase protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00500  Starch and sucrose metabolism
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPN_3724
Enzymes [BR:ypn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     YPN_3724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ABG20051
UniProt: A0A0H2YN75
LinkDB All DBs
Position
4274724..4276787
Genome map
AA seq 687 aa AA seqDB search
MKRLTLPLLLVLSPAAMANWSLQHFPAFTEQDSGIFLSSSSLTKGEYPLKFYQDKQCWQP
TGPVKLNQMLSLQPCQENIAIPWRLFRDGQYQARIDTRSGTPTLTLSVTAPVAEAVQVVT
HVCQRWDGNPVTVDVSKTFAEGEIVRDFYSGQTATVSLGKITLRPAPESGGLLLLESAQT
QQAAPFSWQNATVYFALTDRFNNGNPANDHSYGRHGDGMQEIGTFHGGDLAGLTEKLDYL
QQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYGLDWTRLDANMGTEQDLRTLVE
QAHKRGIRILFDVVMNHVGYATLADMQNDQFGALYLQGDQQEKTLGKRWSDWTPGSGQTW
HSFNDYINFSDKTAWDNWWGKKWIRTDIGDYDTPGYDDLTMSLAFLPDIKTESTQPSGLP
VFYRNKPDTAAQEIAGATPRDYMTHWLSQWVRDYGIDGFRVDTAKHVEKPAWQQLKQQSI
AALAEWKAAHPEQALDNLPFWMTGEAWGHGVMKSDYYQNGFDAMINFDFQDQANQALACF
SSIESTYNQMAEKLQNFNVLSYLSSHDTRLFFKDDAQQSLAKQQRAGSLLLLAPGAVQIF
YGDESGRKFGPTGSDPLQGTRSDMNWSELSGEKGALLAHWQKVSQFRARHPAIGAGVQQS
QQTANYYAFSRQHQGDKVLVVWVGDKN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtctcacactccccttgctactggttctttcaccagcagcgatggcgaactgg
tccctacagcatttcccggcttttactgaacaggacagcggtatttttctcagtagcagc
tcactgaccaaaggcgaataccctctaaaattttatcaggataaacagtgctggcagcca
accgggccggtaaagctgaaccaaatgctctcgttgcagccttgccaggagaatatcgcg
ataccgtggcggttgttccgtgatggccagtatcaagcgcgaatcgatacccgtagcggc
accccgacgctgaccttaagtgtcaccgcacccgtagcggaggcagtccaggtcgtcacc
cacgtttgccaacgctgggatggcaatcctgtgaccgtggatgtcagtaaaacctttgcc
gaaggtgaaattgtacgggatttctattccggccaaacggcaaccgtttctctcggcaaa
attacgttacgacccgccccagagagtggtggtttactgctgttggaatcggcccaaaca
cagcaagccgccccttttagctggcaaaacgctacggtctattttgccctgacggacaga
tttaataacggcaacccagcgaacgaccatagctatggccgtcatggcgatgggatgcag
gagataggaacgtttcacggtggcgatttggcggggcttaccgagaagctggattatctg
caacagcttggggtcaacgcactgtggatcagttctccactggaacaaattcacggctgg
gtcggcggggggaccaaaggcgacttcccacattatgcctatcatggctactacgggctg
gactggacccgtctggatgccaatatgggcaccgaacaggatttacgcacactggttgaa
caggcacataaacgcggcattcgcatcctatttgatgtggtgatgaatcatgtgggttat
gcaacgctggcggatatgcagaacgaccaattcggggcgctctacctgcaaggcgatcag
caggaaaaaaccttgggtaagcgttggagcgactggacccctggcagcgggcagacctgg
cacagctttaatgattacatcaacttcagtgataagaccgcttgggataattggtggggt
aaaaagtggatccgcaccgatattggtgattacgacacccccggttatgacgatctgacg
atgtcgctggccttcctacccgatatcaaaacagaatcgacgcagcccagcggtttgcca
gtgttttaccgtaacaaaccggacaccgcagcccaagaaatcgccggtgcgacaccccgt
gattatatgacgcattggttaagccaatgggtacgcgattacggcattgacggttttcgg
gttgatactgccaagcatgtagagaaacccgcctggcaacaattaaagcagcagagcatc
gcggcactggccgaatggaaagccgcacatccagaacaggcgctggataatctgccattt
tggatgaccggagaggcttggggccacggtgtcatgaaaagtgattactaccaaaatggc
tttgatgccatgattaattttgattttcaggatcaggcaaatcaggcgctggcctgcttc
tcatctatcgagagtacctacaaccaaatggcggagaaactgcaaaacttcaatgtgttg
agctacctctcgtctcacgatacccggttattctttaaagacgatgcacaacagtcactg
gcaaaacagcagcgagcaggctctttactgttgttggctccgggggcagtacaaatcttc
tacggtgatgaaagcgggcggaagtttggcccaaccggttccgatccgttgcagggtacc
cgttcggatatgaactggagtgagctatcgggcgaaaaaggcgcactgttggcccattgg
caaaaagtcagtcaattccgcgcccgtcatcccgcgataggcgctggtgtacaacaatcg
caacaaaccgccaattactatgcctttagccgccaacatcagggcgataaggttctggtc
gtttgggtcggtgataagaactga

DBGET integrated database retrieval system