KEGG   Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_160Help
Entry
BZ17_160          CDS       T03832                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ypo  Yersinia pseudotuberculosis IP 32953 (serotype 1)
Brite
Enzymes [BR:ypo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BZ17_160 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJJ56062
UniProt: Q66A33
LinkDB All DBs
Position
complement(183670..184248)
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVNNLNNLIKDTEFAGKSLEEIVKTA
NGGVFNNAAQVWNHTFYWHCLSPNGGGEPTGKIAEAINKSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKADGTLAIVSTSNAGTPLTTTDKPLLTVDVWEHAYYIDYRNARPKYLENFWA
LVNWSFAEKNLD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattacctgcattaccttacgcgcaaaatgcgctggaaccccacatctct
gccgaaacgctggaataccattatggtaagcaccacaacacctatgtgaacaacctcaat
aatctgattaaagatactgagtttgcaggcaaatcactggaagagatcgtgaaaaccgcc
aatggcggtgtgtttaataatgcggcccaagtttggaaccataccttctactggcattgc
ctgtcgccaaatggaggcggtgaacctactggaaaaatcgccgaggccattaataagtct
tttggctcatttgctgaatttaaagcgcaatttactgatgctgccgtgaaaaacttcggc
gctggttggacgtggctcgttaaaaaagcggatgggacattggcgattgtcagtacctct
aacgcaggaacaccgctgacaacaacagataaacccctgttgaccgtcgatgtgtgggaa
catgcttactatattgattaccgtaatgcgcgaccaaaatatctggagaatttctgggca
ttagttaactggtctttcgctgagaaaaacctagactga

DBGET integrated database retrieval system