KEGG   Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_1800Help
Entry
BZ17_1800         CDS       T03832                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypo  Yersinia pseudotuberculosis IP 32953 (serotype 1)
Brite
Enzymes [BR:ypo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BZ17_1800 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJJ53667
UniProt: Q66ED7
LinkDB All DBs
Structure
PDB: 

Position
complement(1983848..1984417)
Genome map
AA seq 189 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKASMNDKASMTVKINESLPQGNGKALGTVTVTE
TAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHLDPNKTGVHLGPY
NDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDNYSDHPMPLGGGG
ARMACGVIE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggccagcatgaatgataaggctagcatgactgtgaaa
atcaacgaatcattgccacaaggtaatgggaaagcgcttggcaccgtgacggtgactgaa
accgcttatggcttactgtttacgccacatctcactgggctggctccgggaattcacggt
ttccatctgcatgaaaaacccagttgtgctccggggatgaaagatggcaaggcagtgcca
gcattggcagccggggggcatcttgacccaaataagaccggggtacaccttggtccttac
aacgataaagggcatctgggggatctgccgggattggtggttaatgcagatggcaccgcc
acctatcccgtattggctccgcgcctgaaatcgttgtcagaggtgaaacagcatgcgtta
atgatccatgctggcggtgataattactctgatcatccaatgcctttaggcggtggtggc
gcacggatggcatgtggagtcattgagtaa

DBGET integrated database retrieval system