KEGG   Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_23Help
Entry
BZ17_23           CDS       T03832                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ypo  Yersinia pseudotuberculosis IP 32953 (serotype 1)
Pathway
ypo00020  Citrate cycle (TCA cycle)
ypo00480  Glutathione metabolism
ypo01100  Metabolic pathways
ypo01110  Biosynthesis of secondary metabolites
ypo01120  Microbial metabolism in diverse environments
ypo01130  Biosynthesis of antibiotics
ypo01200  Carbon metabolism
ypo01210  2-Oxocarboxylic acid metabolism
ypo01230  Biosynthesis of amino acids
Module
ypo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ypo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BZ17_23 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BZ17_23 (icd)
Enzymes [BR:ypo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BZ17_23 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AJJ53983
UniProt: Q669Q7
LinkDB All DBs
Position
24962..26215
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKEIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgacggtattggtgtt
gatgtaaccccggcgatgatcaacgtggtagatgctgcggttaagaaagcttataacggt
gaacgtaaaatttcctggatggaaatttacactggtgagaaatcaacccatgtctatggt
aaagatgtttggttgccagaagaaaccttagatctgatccgtgattatcgcgttgctatc
aaaggcccgttgaccactcctgtcggtggcggcatccgttctttgaacgttgctctgcgt
caacaacttgacctgtatgtgtgtctgcgtccggtgcgttattatgaaggcaccccaagc
ccggtaaaacaccctgaactgaccaacatggtgattttccgtgaaaacgctgaagatatc
tatgcgggtatcgaatggaaagcgggttcacccgaagcagagaaagtgatcaagttcctg
cgtgaagagatgggtgtgaagaaaatccgtttccctgaacaatgtggtatcggtgtgaaa
ccgtgttcagaagaagggactaagcgtttggtacgtgcagcgattgaatatgcaattacc
aacgatcgtgaatcagttacgctggttcataaaggcaacattatgaaattcaccgaaggc
gcgtttaaagactggggttatcagttagcgcgtgaggaatttggtggtgaactgatcgac
ggtggcccatgggttaaaatcaaaaacccaaataacggcaaagaaattatcgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgtcctgcggaatatgatgttatc
gcttgtatgaacctgaacggtgattacatctctgatgcattggcagctcaggttggcggt
attggtattgctccgggggctaacattggtgatgactgcgcactgttcgaagccactcac
ggtactgcaccaaaatatgctggtcaggataaagtgaacccaggttctattattctttca
gcagaaatgatgctgcgtcacatgggctggttcgaagccgctgacttaatcattaaaggc
actgaaggcgcaattcaagccaagaccgtgacttatgatttcgaacgtctgatggaaggc
gctaagttgttgaagtgtagtgagtttggcgacgccattattaagcacatgtaa

DBGET integrated database retrieval system