KEGG   Yersinia pseudotuberculosis IP 32953 (serotype 1): BZ17_2655Help
Entry
BZ17_2655         CDS       T03832                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ypo  Yersinia pseudotuberculosis IP 32953 (serotype 1)
Brite
Enzymes [BR:ypo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BZ17_2655 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJJ57189
UniProt: Q663U9
LinkDB All DBs
Position
2954511..2955134
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELADLSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLAGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGVSGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcactgccttatgcttatgatgccttagaaccacacttcgat
aagcagacgatggaaatccatcacaccaaacaccatcagacctatgttaacaatgcaaat
acggtgttggagagcttcccggagctggcggacctgagcgttgaagatctgatcaaagat
ctggataaagtccctgctgaaaagcgcacctttatgcgtaacaacgcaggcggccacgct
aaccacagtctgttctggaaaggcctgaaactgggcaccaccctagccggtgacctgaaa
gccgctatcgagcgcgatttcggcagcgtagacagcttcaaagaaaaatttgaacaagct
gctgcgacccgtttcggttctggctgggcttggctggtactgaaagacgacggcaaactg
gcggttgtttcaaccgctaaccaagacagcccgctgatgggcgaagccgtttctggcgta
tcaggtttcccgattgtgggcctggacgtatgggaacacgcttactacctgaaattccaa
aaccgccgcccagactacatcaaagccttctggaacgtggttaactgggacgaagctgca
gcgcgtttcgctcaagccaagtaa

DBGET integrated database retrieval system