KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_0835
Entry
YPDSF_0835        CDS       T00505                                 

Definition
(GenBank) two-component regulatory system, sensor kinase protein
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YPDSF_0835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypp01001]
    YPDSF_0835
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypp02022]
    YPDSF_0835
Enzymes [BR:ypp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     YPDSF_0835
Protein kinases [BR:ypp01001]
 Histidine kinases
  OmpR family
   YPDSF_0835
Two-component system [BR:ypp02022]
 OmpR family
  RstB-RstA
   YPDSF_0835
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3 HATPase_c_5
Other DBs
NCBI-ProteinID: ABP39240
LinkDB
Position
complement(946088..947365)
AA seq 425 aa
MLLFVCFMVMAMLVGLVYKVTAERAGRQSLDDLMKSSLSLMRSELREIPLKDWNKTIATL
DLNLSFQLHIEPLDKRDLGAQLNKRLRAGEIIALDDEYTFLQRIPRSHYVLAVGPVPYLF
YLHQMRLLDLALLILIGLSLALPVFLWMRPHWKDLLKLENAAQRLGSGHLDERTHFDPTS
SLSRLGVAFNQMADNINTLIVSKKLLIDGIAHELRTPLVRLRYRLAMSDNLTESEQQALH
HDIGQLEALIDELLTYARLDRPQVSLNLEPIDLPAWLTTKIMDIRSIHQEREIELDIPHR
GDFGAVDLRLMERVLDNLVNNALRYSHQRLRIGLWFDGDNACLQVEDDGPGIPPEERTRI
FEPFVRLDPSRDRATGGCGLGLAIVHSIALAYQGSISVNTSPLGGASFRFSWPIKTHLPL
SADQN
NT seq 1278 nt   +upstreamnt  +downstreamnt
ttgttgttattcgtttgcttcatggtgatggcgatgctggttggcctggtttataaggtc
accgctgagcgcgcgggtcgtcagtctttagatgacctgatgaaaagttcactatcactg
atgcgcagcgaattgcgggagatcccgctaaaagactggaataaaaccatcgcaacatta
gatttaaatctttcttttcaacttcatatcgaaccattagataaacgtgatcttggcgca
caattgaacaaacggctacgtgcgggtgaaattattgcattggatgatgaatataccttc
ctgcaacgtatccctcgtagccactatgttctggcggttggcccggtcccttatctattt
tatttacaccagatgaggctgctcgatttagcattattaatcttgattggcctgtcgtta
gctcttccggtatttctctggatgagaccgcactggaaagatcttctcaaattagaaaat
gccgctcagagactgggctcaggccaccttgacgagcggactcatttcgaccccacttcc
agtctaagccgtttaggcgtggcttttaaccaaatggctgacaacatcaacaccctgatt
gttagcaaaaaattactgattgatggtatagcacacgaactacggacaccattggtacgc
ttacgttatcgattagcgatgagtgataacctgaccgaaagcgaacagcaggcgttacat
catgatatcggtcaattggaagcacttattgatgaactactgacctatgcacgtttggat
cgcccacaagtttccctcaatctggaacctatcgacctaccggcctggctaacaaccaaa
atcatggatatccgctcgattcatcaagagcgtgagatcgaacttgatattccccaccgt
ggtgattttggtgccgttgacctgcgtctgatggagcgagtgctggataacctggtcaat
aatgccctacgctattcacatcaacggctgcgcatagggttatggttcgatggcgataac
gcctgcctacaggttgaagatgacggccccggtatcccgccagaagaacggacacgaatt
tttgaaccctttgttcgtttagaccccagccgtgatcgcgccactggtggctgtggattg
gggctggccattgtccattcgattgcactggcctatcaaggcagtatctctgtcaatacc
agtccattaggtggggccagtttccgctttagttggccgataaaaacacatttgcctcta
tccgctgatcagaattaa

DBGET integrated database retrieval system