KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_2984Help
Entry
YPDSF_2984        CDS       T00505                                 

Definition
(GenBank) superoxide dismutase (Cu-Zn) precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
Enzymes [BR:ypp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YPDSF_2984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABP41344
LinkDB All DBs
Position
3390860..3391465
Genome map
AA seq 201 aa AA seqDB search
MKLSTLLLPVILYSSATLAANMAGMNDKASMNDKASMNDMASMNGKASMTVKINESLPQG
NGKALGTVTVTETAYGLLFTPHLTGLAPGIHGFHLHEKPSCAPGMKDGKAVPALAAGGHL
DPNKTGVHLGPYNDKGHLGDLPGLVVNADGTATYPVLAPRLKSLSEVKQHALMIHAGGDN
YSDHPMPLGGGGARMACGVIE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagtacattattgctacctgttattctttactccagcgcaacactggccgct
aacatggctggcatgaatgataaggccagcatgaatgataaggccagcatgaatgatatg
gccagcatgaatggtaaggctagcatgactgtgaaaatcaacgaatcattgccacaaggt
aatgggaaagcgcttggcaccgtgacggtgactgaaaccgcttatggcttactgtttacg
ccacatctcactgggctggctccgggaattcacggtttccatctgcatgaaaaacccagt
tgtgctccggggatgaaagatggcaaggcagtgccagcattggcagccggggggcatctt
gacccaaataagaccggggtacaccttggtccttacaacgataaagggcatctgggggat
ctgccgggattggtggttaatgcagatggcaccgccacctatcccgtattggctccgcgc
ctgaaatcgttgtcagaggtgaaacagcatgcgttaatgatccatgctggcggtgataat
tactctgatcatccaatgcctttaggcggtggtggcgcacggatggcatgtggagtcatt
gagtaa

DBGET integrated database retrieval system