KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_3074Help
Entry
YPDSF_3074        CDS       T00505                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Pathway
ypp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypp01100  Metabolic pathways
ypp01110  Biosynthesis of secondary metabolites
ypp01130  Biosynthesis of antibiotics
ypp01230  Biosynthesis of amino acids
ypp02024  Quorum sensing
Module
ypp_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YPDSF_3074
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YPDSF_3074
Enzymes [BR:ypp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     YPDSF_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ABP41432
LinkDB All DBs
Position
3485295..3486248
Genome map
AA seq 317 aa AA seqDB search
MIMQKDSLNNVHISAEQILITPEELKNQFPLSENDQYSIERARKTIADIIQGRDPRLLVV
CGPCSIHDVDAALDYARRLKKLSVELDDSLYIVMRVYFEKPRTTVGWKGLINDPAMDGSF
DVEAGLHIARRLLLDLVGMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMAS
GLSMPVGFKNGTDGSLGTAINAMRAAAMPHRFMGINQSGQVCLLQTQGNPHGHVILRGGK
TPNYSAQDVAQCEKQMQDAGLIPSLMIDCSHGNSNKDYRRQVAVAESVVEQIKAGNRSCN
ERCNSDPHPTPEIRSRG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgcaaaaagactcgctcaataacgtccatatcagtgccgaacaaatcctgata
accccggaagaactgaaaaatcagtttccactgagcgaaaatgatcagtattcgatagag
cgcgcacgtaaaaccattgctgacattattcaggggcgagatccgcgtctgttggtcgtt
tgtgggccctgttcaattcatgatgtggatgcggcactggattacgcgcgtcgtttgaaa
aaactctctgtggaattggatgacagcttatatatcgttatgcgtgtctattttgagaag
ccaagaactaccgtgggttggaaaggcctgatcaatgaccctgcaatggatggttcattt
gatgtagaggcaggtttacacattgcccgtcgtttattgctggatttagtgggcatgggg
ttgccgttagcgactgaagctctggatcctaatagcccacaatatttaggtgacctgttc
agttggtcggccattggtgcccgtacaacggagtcacagacccaccgtgaaatggcatca
ggcttgtctatgccggttggatttaaaaatggcactgacggtagcctaggcacggcaatc
aatgcaatgcgcgccgctgccatgccacatcgctttatggggatcaatcagtcgggccag
gtctgcctgttacaaactcagggtaacccacacggccatgtcattctacggggaggtaaa
acaccaaactacagtgcacaagatgtcgctcagtgtgaaaaacagatgcaggatgcggga
ctcatcccatccttaatgatagattgcagtcacggtaattcaaataaagactaccgccgt
caggttgcggtggctgaatctgtggttgaacagatcaaggcgggcaatcgttcatgtaac
gaacggtgcaatagtgatccacacccaacgcctgaaatcagatccagggggtaa

DBGET integrated database retrieval system