KEGG   Yersinia pestis Pestoides F (biovar Antiqua): YPDSF_3752Help
Entry
YPDSF_3752        CDS       T00505                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
ypp  Yersinia pestis Pestoides F (biovar Antiqua)
Brite
KEGG Orthology (KO) [BR:ypp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ypp03012]
    YPDSF_3752
   03029 Mitochondrial biogenesis [BR:ypp03029]
    YPDSF_3752
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypp04147]
    YPDSF_3752
Translation factors [BR:ypp03012]
 Eukaryotic Type
  Elongation factors
   YPDSF_3752
 Prokaryotic Type
   YPDSF_3752
Mitochondrial biogenesis [BR:ypp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YPDSF_3752
Exosome [BR:ypp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YPDSF_3752
  Exosomal proteins of breast cancer cells
   YPDSF_3752
  Exosomal proteins of colorectal cancer cells
   YPDSF_3752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C cobW
Motif
Other DBs
NCBI-ProteinID: ABP42098
UniProt: A4TS36
LinkDB All DBs
Position
complement(4313607..4314791)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDAEWEAKIIELAEALDSYIPQPERAIDRPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIIDTIKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVQRGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaagccgcacgttaatgtgggtactattggccac
gttgaccatggtaaaactaccttaactgctgcaatcaccaccgtattggctaaaacctac
ggcggtagtgctcgtgcattcgaccagatcgacaacgctccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatatgatactcctgctcgtcactatgcacacgtt
gactgcccaggtcatgctgactacgttaaaaatatgatcaccggtgctgctcagatggat
ggagcgatcttggttgttgctgcaaccgatggccctatgccgcagactcgtgagcatatc
ctgctgggccgccaggttggtgtcccatacattattgtcttcctgaacaaatgtgacatg
gttgacgatgaagagttgctagagttggttgaaatggaggttcgtgagcttctgtctcaa
tacgatttcccaggcgacgacactccagtcatccgtggttcagcgttgaaagccctggaa
ggtgacgctgagtgggaagctaaaattatcgagttggcagaagctctggatagctatatt
ccgcaaccagaacgcgctattgatagaccattcctattgccaattgaagacgtattctct
atttctggtcgtggtactgtagttactggtcgtgtagaacgcggtattgttaaggtcggc
gaagaagttgaaatcgttggtattatcgatacgattaaaacaacttgtactggcgttgaa
atgttccgcaagctgctggatgaaggccgtgctggtgaaaatgttggtgttctgctgcgt
ggtactaagcgtgacgatgttcagcgtggtcaagtactggcgaaaccaggttctatcaag
ccacacacgaagtttgagtcagaagtttatattctgagcaaagatgaaggcggccgtcat
acaccgttcttcaagggctaccgtcctcagttctacttccgtacaactgacgtgaccggt
accattgagctgccagaaggcgttgaaatggtcatgcctggtgacaacgtaaacatggtt
gttaacctaattgctcctatcgcaatggatgatggtctgcgcttcgcaattcgtgagggt
ggccgtactgttggtgctggcgttgttgctaaagtcattgaataa

DBGET integrated database retrieval system