KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_1502Help
Entry
DJ40_1502         CDS       T03307                                 

Definition
(GenBank) amidohydrolase, AtzE family protein
  KO
K22601  oxamate carbamoyltransferase [EC:2.1.3.5]
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq00230  Purine metabolism
ypq01100  Metabolic pathways
ypq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DJ40_1502
Enzymes [BR:ypq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.5  oxamate carbamoyltransferase
     DJ40_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AIN13397
LinkDB All DBs
Position
1634257..1635654
Genome map
AA seq 465 aa AA seqDB search
MKPASSLTISEIQQALHKGELSAQAIAQQTLDAITVANPLINAYTYITADRMLSEACRLD
TLRAKGQPLPALAAVPYAVKNLFDVAGETTLSGASLFCDQAPAKQDAWAISCLSRQGAML
SGMLNMDAYAYGFTTENSHYGATHNPHDLNRIAGGSSGGSAAAVAAGLVHFSLGSDTNGS
IRVPSSLCGIFGLKPTFGRLSRRGTHPFVASLDHIGPMARCTQDLAVVYDVMQGIDTQDN
FQADQPVTPCQNLLTRGQQGLRSAVLGGYFHQWSDDDAKAAVLAVAKALEANAEVEMPQS
DLARSAAFIISASEGGNQYLPALRKSPQRFEPLSRERLLAGAMLPATWYVQAQRFRHHFR
QHILPLFEHWDILIAPATPCSATLIGQDTMRINDMDLPIRASMGILTQPISFLGLPVVSV
PLKTTRGLPIGIQLIAPPWREDLCLRAAYALEQQGLVSAPVSTVI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgcctcatcactcactatcagcgagatccaacaagccctgcacaagggcgaa
ttatccgcacaagcgatcgcacagcagacgttggacgccattaccgtcgccaatccgctc
atcaacgcttatacctatatcaccgctgaccgtatgcttagcgaagcttgtcggctagat
acgctacgcgccaaaggccagccgctgccagcactggcggcagtcccttatgcggtcaag
aatctgttcgatgttgccggagaaacaaccctatcaggtgccagcttattttgtgatcaa
gcccccgccaaacaggatgcctgggccatttcatgcctgagccgccaaggagccatgctc
tccggcatgttaaatatggatgcctatgcttacggttttactaccgagaacagccattat
ggtgccacccataatccacacgatctgaaccgcattgcagggggatcttctggcggatct
gcggcagcggtcgccgcagggctcgtgcacttttctctcggcagtgatactaacggttcg
atccgggttccctcctcactgtgtggtatttttgggctgaaaccaacctttggccgcctg
tcacgccgcggcacccacccatttgtcgccagtctggaccatatcggcccaatggcacgc
tgtacgcaagatttggcggtggtttatgacgtgatgcaaggcatcgatactcaggataat
tttcaagccgatcaacccgtcacgccgtgccaaaatttactgacgcgtggtcagcaaggg
ttaagaagcgcggtgctgggcggttactttcatcaatggagtgatgatgacgccaaagcc
gcagtgctggcggtcgcaaaggcgcttgaggctaacgcggaggtcgagatgccgcagagt
gatttagcccggtcagcggcatttattatcagtgccagcgagggcggcaatcaatatctg
cccgccttgaggaaatcacctcaacgttttgaacccctatcacgggagcggttattagcc
ggagccatgctaccggcaacttggtacgtacaggcccagcgtttccgtcatcattttcgc
caacacattttgccgctgttcgagcactgggatattttgattgccccagcaacgccatgc
agtgccacgcttatcggccaggacacgatgaggattaatgatatggacctaccgatccgc
gccagtatgggcatattaacccagccaatctccttcctgggtctgccagtcgtgagcgta
cccttgaaaaccacccgcggcttaccaattggcattcagttgattgccccaccatggcga
gaagatttatgcctgcgcgcggcttatgcgctggagcaacaagggttggtcagcgcgccg
gtgagtactgttatttga

DBGET integrated database retrieval system