KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_1680Help
Entry
DJ40_1680         CDS       T03307                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq00473  D-Alanine metabolism
ypq00550  Peptidoglycan biosynthesis
ypq01100  Metabolic pathways
ypq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DJ40_1680 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DJ40_1680 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DJ40_1680 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypq01011]
    DJ40_1680 (ddlB)
Enzymes [BR:ypq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DJ40_1680 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:ypq01011]
 Precursor biosynthesis
  Amino acid ligase
   DJ40_1680 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_ST ATPgrasp_YheCD TTL RimK ATPgrasp_Ter GARS_A
Motif
Other DBs
NCBI-ProteinID: AIN12797
UniProt: A0A3G5KFA8
LinkDB All DBs
Position
complement(1843596..1844516)
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKEQGFDKVFI
ALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQALGLPISPYVALNRQ
QFETLSPEELVACVAKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVEAFQHDSDVLIE
KWLSGPEFTVAILGDEVLPSIRIQPPGVFYDYDAKYLSDKTQYFCPSGLSDESEQQLAAL
ALQAYHALDCSGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVAR
ILMLAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaagtcgcggtattgctgggtgggacctctgcggagcgtgaagtgtcatta
ctgtcaggtcaggcggtattggcaggcttgaaagaagccggtatcgatgcttatggggtg
gataccaaagattttccggtaactcagcttaaagaacagggctttgataaagtgtttatc
gccctgcatggtcgtggtggcgaagacggtacgttacaaggcgtattggaatttctacaa
ctgccatataccggcagtggtgtaatggcatccgccctgacaatggacaaattgcgcacc
aaattagtctggcaagccttggggttgcctatttcgccttatgttgcgttgaatcgccaa
cagtttgaaacactttccccagaggaattggtggcgtgtgtcgctaagcttggcctgcca
cttattgtcaagccaagccatgaaggctctagcgttgggatgagtaaagttgatcacgcc
agcgaattgcagaaggcattggttgaagctttccaacatgacagcgatgtactgattgag
aaatggctgagcgggccagagtttactgtcgcgatccttggggatgaagttttgccttct
attcgtattcagcctccgggcgtgttttacgattatgacgctaagtatttgtcagataaa
acacaatacttctgcccaagcggtttaagtgatgagtcggagcaacaattggcagcgctg
gcattgcaggcttaccacgcgctggattgcagcggttgggggcgggtcgatgtgatgcaa
gaccgcgatggtcatttttacctgcttgaagtgaacacttcaccgggtatgaccagccat
agtttggttccaatggccgcccgccagtatgggttgagtttctcccaattggtggcgcgc
attctgatgttggctgactga

DBGET integrated database retrieval system