KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_1866Help
Entry
DJ40_1866         CDS       T03307                                 

Definition
(GenBank) ABC transporter family protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DJ40_1866
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypq02000]
    DJ40_1866
Transporters [BR:ypq02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    DJ40_1866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_16 NACHT RsgA_GTPase IstB_IS21 Mg_chelatase AAA_29 DUF87 AAA_7 DUF815 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AIN15136
UniProt: A0A2A7VMW9
LinkDB All DBs
Position
2066510..2067388
Genome map
AA seq 292 aa AA seqDB search
MTDSIFTVDNLCVDFQQQRVVDNISFHLGHERVALVGESGSGKSITARALMGLVRHPGKV
SAKKLSYYSDNTDDQGHSGQIIEHDLLRLNTRQWSALRGSEIAMVLQDPRYALNPVQPVG
KQIEESLLLHNTLSSADAHERVLNALASVGLNASAYHSYPGQLSGGMGQRAMLAIALVNN
PRVLIADEPTSALDAKLRNQILELIVEQTEQRKMSLLLISHDLPLVAEHCHRVLVMYQGK
LVDQGLAADLPHSTHPYTHTLWACRPNAHTYGTDLPVLDRSVDFSGGSRGTD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgactgattctatttttaccgtcgataacctgtgcgtcgattttcagcaacagcgggtg
gtggataacatttcgttccacctcggtcacgaacgtgttgctctcgtaggcgaatccggc
tccgggaaatcgatcacggccagagcgctgatgggcttagtcaggcaccccggtaaagtc
agtgccaagaagctgagttattactctgacaacacggatgatcagggccattccggtcag
attattgaacacgatttactgcgcctaaacaccaggcaatggagcgcattacggggcagt
gaaattgctatggtgttacaagacccccgttatgccttaaatccggtacaacctgttggt
aagcagattgaagagtctctgttgctgcataacaccctttcaagcgctgatgcgcatgaa
cgggtattaaatgcactggcctcggttgggttaaatgccagcgcttaccacagctacccc
ggccagctttctggtggtatggggcaacgcgcgatgctggcaatcgctttggtgaataat
cccagagtattaattgccgatgaaccgacatccgcgttagatgccaaattacgcaaccag
atccttgaattaattgttgagcaaaccgaacaacgaaaaatgagcctgttgctgatcagc
catgacctgccattagtcgccgaacattgtcatcgcgtgttagtgatgtatcaggggaag
ttggtcgatcaaggtctggccgctgatctgccccattcaacccacccttatacccacacg
ctatgggcttgccgcccgaatgcccatacctatggcaccgatctgccggtattggatcgc
agcgtagatttctccggaggctcccgtggcactgattga

DBGET integrated database retrieval system