KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_2033
Entry
DJ40_2033         CDS       T03307                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq00473  D-Alanine metabolism
ypq01100  Metabolic pathways
ypq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DJ40_2033 (alr)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DJ40_2033 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypq01011]
    DJ40_2033 (alr)
Enzymes [BR:ypq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DJ40_2033 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ypq01011]
 Precursor biosynthesis
  Racemase
   DJ40_2033 (alr)
SSDB
Motif
Pfam: Ala_racemase_N Ala_racemase_C FCD
Other DBs
NCBI-ProteinID: AIN13948
UniProt: A0A3G5IUQ4
LinkDB
Position
complement(2240889..2241968)
AA seq 359 aa
MKAATAVIDRHALRHNLQQIRRLAPQSRLVAVVKANAYGHGLLAAAHTLQDADCYGVARI
SEALMLRAGGIVKPILLLEGFFDAEDLPVLVANHIETAVHSLEQLVALEAATLSAPINAW
MKLDTGMHRLGVRPDQAEAFYQRLSACRNVIQPVNIMSHFSRADEPEVAATQQQLACFDA
FAAGKPGKQSIAASGGILRWPQAHRDWVRPGIVLYGVSPFDAPYGRDFGLLPAMTLKSSL
IAVREHKAGESVGYGGTWVSERDTRLGVIAIGYGDGYPRSAPSGTPVWLNGREVSIVGRV
SMDMISIDLGPESTDKVGDEALMWGAELPVERVAACTGISAYELITNLTSRVAMEYLGE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaaagcggcaacagcagtcatcgaccgccatgctctgcgacataacttacaacaaatt
cggcgtctggcaccgcaaagccggttggtggctgttgtgaaagcaaatgcttatggccac
gggttattagccgcagcacacacattacaggatgctgattgttatggcgtggcccgtatt
agcgaggcgctgatgttgcgagcgggtggaatagttaaacctattttgctgctggaaggg
ttctttgatgcagaagacctgccggtattggtggctaaccacattgaaaccgccgttcac
agcctggaacagctcgtggcattggaagcggctacgctttctgcgccgattaatgcctgg
atgaaattggatacggggatgcaccgcctgggggttcgcccagatcaggccgaagcgttt
tatcagcgtttgagcgcatgccgtaacgtcatccagccggtcaatatcatgagtcacttt
agccgtgccgatgaacctgaagtggcggccacgcaacagcaactggcgtgttttgatgcg
tttgctgcaggtaaacctgggaaacaatctatcgctgcttcgggcggtattctgcggtgg
ccacaagcgcaccgtgattgggtgcgcccagggattgtgctgtatggggtttcgccgttt
gatgcgccctatggccgtgatttcggtttattgcccgccatgaccctgaaatccagtctg
atcgcggtgcgtgaacataaagctggtgaatcggtcgggtatggcggcacctgggtcagt
gagcgcgatacgcgtttaggtgtgatcgcgataggctatggtgatggctacccacgtagc
gccccgtcagggacaccggtatggcttaatggccgtgaagtgagcatcgttggccgggta
tcgatggacatgatctccattgatcttggcccggaaagtacagataaggtgggcgatgaa
gccctgatgtggggagccgaattaccggttgaacgcgtggctgcctgcaccggtatcagc
gcgtatgaattgatcactaatctgacctcccgcgtagcgatggaatatctaggggaataa

KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_4176
Entry
DJ40_4176         CDS       T03307                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq00473  D-Alanine metabolism
ypq01100  Metabolic pathways
ypq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DJ40_4176 (alr)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DJ40_4176 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ypq01011]
    DJ40_4176 (alr)
Enzymes [BR:ypq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DJ40_4176 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ypq01011]
 Precursor biosynthesis
  Racemase
   DJ40_4176 (alr)
SSDB
Motif
Pfam: Ala_racemase_N Ala_racemase_C QRPTase_C AbiEi_3_N
Other DBs
NCBI-ProteinID: AIN13038
LinkDB
Position
complement(4690768..4691997)
AA seq 409 aa
MHVRFRHLFLLPLITLVACSQPVSKNHLSLTSLSANAQQPVVNNAWLEISQGALDFNTKK
MLTLLDNKSTLCAILKGDAYGHDLTLVTPVMLKNNVQCIGVASNQELKMVRDLGFTGQLI
RVRSATLKEMQQAMAYDVEELIGDKTVAEQLNNIAKLNGKVLRIHLALNSAGMSRNGLEV
SKARGLNDAKTIAGLKNLTIVGIMSHYPVEDASEIKADLARFQQQAKDVIAVTGLKREKI
KLHVANTFATLAVPDSWLDMVRVGGVFYGDTIASTEYKRVMTFKSNIASLNNYPKGGTVG
YDRTYTLKRDSLLANIPVGYADGYRRVFSNAGHVIIQGQRLPVLGKTSMNTVIVDVTDLK
KVSLGDEVVLFGKQGNAEIQAEEIEDLSGALFTEMSILWGATNKRILVD
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcacgttcgttttcgtcatttattcttattaccattaataactttggtcgcttgtagc
caacccgtatcaaaaaaccatcttagcctgacctcactatctgccaacgcccagcaacct
gtagtaaataatgcgtggcttgaaatctctcaaggtgcgctggatttcaatactaaaaag
atgcttacactgctggataataaatccacactttgtgcaatattaaaaggtgatgcctat
ggacatgacctgaccttagtcacaccggtgatgctaaaaaacaatgtgcaatgtattggg
gttgccagcaatcaggaactaaaaatggtacgtgatctaggatttacggggcagttgata
cgggtcagaagtgcaacattaaaagaaatgcaacaagctatggcttacgatgttgaagaa
cttattggcgataaaaccgtcgctgagcagttaaataatattgcaaaactgaatggaaaa
gttctgcgtatccatctggcactgaactccgcagggatgtctcgtaatgggctggaggtc
agtaaggcccgcggtttaaatgacgcaaagacaattgcaggtttaaaaaatctgacaatc
gttggcatcatgtcgcactacccggtggaagatgctagcgaaatcaaagcagacttggct
cgattccagcaacaagccaaagatgttatcgcggtcacggggctaaaacgtgaaaagatt
aagctccacgtcgccaatacattcgcgaccttagcggtgcctgattcatggttggatatg
gtccgtgtgggaggggtgttttatggtgacaccatcgccagcacagagtataagcgggtc
atgaccttcaaatctaacatcgcatcgctgaacaactaccctaagggcggtactgttggc
tatgaccggacctatacattgaaacgtgattccctgctggcgaatatccccgtgggttat
gccgatgggtatcgccgagtatttagtaatgcggggcatgtgattattcaaggtcagcgc
ctgcccgtattaggcaaaacatcaatgaatacggtcatagtagacgtcaccgatctgaaa
aaagtgagtttaggtgatgaagttgtcttgttcggtaagcaaggcaatgcggaaattcag
gcagaagaaattgaagatctcagtggcgcactctttaccgaaatgtcaattctgtggggc
gcaaccaataagcgtattctggtagattaa

DBGET integrated database retrieval system