KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_2136Help
Entry
DJ40_2136         CDS       T03307                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Brite
Translation factors [BR:ypq03012]
 Eukaryotic Type
  Elongation factors
   DJ40_2136 (tuf)
 Prokaryotic Type
   DJ40_2136 (tuf)
Mitochondrial biogenesis [BR:ypq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DJ40_2136 (tuf)
Exosome [BR:ypq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DJ40_2136 (tuf)
  Exosomal proteins of breast cancer cells
   DJ40_2136 (tuf)
  Exosomal proteins of colorectal cancer cells
   DJ40_2136 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C cobW
Motif
Other DBs
NCBI-ProteinID: AIN16268
UniProt: A0A2A7VMF5
LinkDB All DBs
Position
complement(2357556..2358740)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDAEWEAKIIELAEALDSYIPQPERAIDRPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIIDTIKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVQRGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaagccgcacgttaatgtgggtactattggccac
gttgaccatggtaaaactaccttaactgctgcaatcaccaccgtattggctaaaacctac
ggcggtagtgctcgtgcattcgaccagatcgacaacgctccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatatgatactcctgctcgtcactatgcacacgtt
gactgcccaggtcatgctgactacgttaaaaatatgatcaccggtgctgctcagatggat
ggagcgatcttggttgttgctgcaaccgatggccctatgccgcagactcgtgagcatatc
ctgctgggccgccaggttggtgtcccatacattattgtcttcctgaacaaatgtgacatg
gttgacgatgaagagttgctagagttggttgaaatggaggttcgtgagcttctgtctcaa
tacgatttcccaggcgacgacactccagtcatccgtggttcagcgttgaaagccctggaa
ggtgacgctgagtgggaagctaaaattatcgagttggcagaagctctggatagctatatt
ccgcaaccagaacgcgctattgatagaccattcctattgccaattgaagacgtattctct
atttctggtcgtggtactgtagttactggtcgtgtagaacgcggtattgttaaggtcggc
gaagaagttgaaatcgttggtattatcgatacgattaaaacaacttgtactggcgttgaa
atgttccgcaagctgctggatgaaggccgtgctggtgaaaatgttggtgttctgctgcgt
ggtactaagcgtgacgatgttcagcgtggtcaagtactggcgaaaccaggttctatcaag
ccacacacgaagtttgagtcagaagtttatattctgagcaaagatgaaggcggccgtcat
acaccgttcttcaagggctaccgtcctcagttctacttccgtacaactgacgtgaccggt
accattgagctgccagaaggcgttgaaatggtcatgcctggtgacaacgtaaacatggtt
gttaacctaattgctcctatcgcaatggatgatggtctgcgcttcgcaattcgtgagggt
ggccgtactgttggtgctggcgttgttgctaaagtcattgaataa

DBGET integrated database retrieval system