KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_24Help
Entry
DJ40_24           CDS       T03307                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq00480  Glutathione metabolism
ypq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DJ40_24 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypq02000]
    DJ40_24 (gst)
Enzymes [BR:ypq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DJ40_24 (gst)
Transporters [BR:ypq02000]
 Other transporters
  Pores ion channels [TC:1]
   DJ40_24 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AIN15091
LinkDB All DBs
Position
complement(23462..24067)
Genome map
AA seq 201 aa AA seqDB search
MKMFYKPGACSLSSHIVLREAGLDFSIERVDLVTKKTETGADYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPNTPDE
YKTIVRERLDKQFSYVDSVLAEHDYLLGKKFSVADAYLFTVSRWANALNLQIKERSHLDQ
YMARVAERPAVKAALAAEDIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgttctataaaccgggtgcttgttctctgtcctcccatattgtgttgcgggaa
gcaggactagatttcagcattgaacgtgttgatttagtgacaaaaaagactgaaacgggt
gcagactatttaagcatcaaccccaaaggacaagtaccggccttagtgctggatgacggt
agcctactgactgaaggggtagctattgtgcaatatttggcagataaagtcccagaccgc
cacttgattgccccatcagggacgctctcgcgctatcatgccattgagtggctgaatttt
atcgcgactgaactacataaaggttttagcccactatttaatccaaatacaccagatgag
tataagacgattgtccgcgagcggctggataagcaattcagctacgttgatagcgtatta
gcagagcatgattatctactaggtaaaaaattcagtgtggcagatgcctacttatttacc
gttagccgttgggctaatgcgttaaatcttcaaatcaaagaacgcagccatttggatcaa
tatatggcgcgggtcgctgaacgccctgcggtaaaagcagctttagccgccgaagatatc
aagtaa

DBGET integrated database retrieval system