KEGG   Yersinia pseudotuberculosis ATCC 6904: DJ40_686Help
Entry
DJ40_686          CDS       T03307                                 

Gene name
maeA
Definition
(GenBank) NAD-dependent malic enzyme
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
ypq  Yersinia pseudotuberculosis ATCC 6904
Pathway
ypq00620  Pyruvate metabolism
ypq01200  Carbon metabolism
ypq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DJ40_686 (maeA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DJ40_686 (maeA)
Enzymes [BR:ypq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     DJ40_686 (maeA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malic_M malic DUF2478
Motif
Other DBs
NCBI-ProteinID: AIN14072
UniProt: A0A3G5KPF6
LinkDB All DBs
Position
738987..740684
Genome map
AA seq 565 aa AA seqDB search
MELEYESKRPLYIPYAGPILLEFPLLNKGSAFTNDERNHFNLHGLLPEAVETIEEQAERA
YRQYQDFKNDDDKHIYLRNIQDTNETLFYRLLEAHLSEMMPIIYTPTVGEACEHFSDIYR
RARGLFISYPNREHIDDMLQNATKQNVKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYT
ACGGISPAYTLPVVLDVGTNNPQRLNDPLYMGWRHPRISGDEYYAFVDEFIQAVKRRWPN
VLLQFEDFAQKNATPLLNRYRDELCCFNDDIQGTAAVTLGSLIAASHAAGSQLRDQTVTF
LGAGSAGCGIAEQIIAQMMSEGLSEIQARARIFMVDRFGLLTDKLPNLLDFQSKLVQKSD
DLHHWNLHNDAISLLDVVRNAKPTVLIGVSGQPGLFTEELIREMHSHCARPIVMPLSNPT
SRVEARPEDIINWTDGAALVATGSPFPPVSYKEKLYPIAQCNNSYIFPGIGLGVLASGAS
RVTDGMLMAASRALAESSPLARHGEGALLPNIDDIQAVSKAIAMRVGQAAQLQGVAIVTS
EEALSKAIEHNYWQPQYRSYKRTSF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgaatacgaaagtaagcgccccctgtacatcccctacgctggtccaatattg
ctggagttcccacttctcaataaaggcagtgcttttaccaatgatgagcgtaatcatttc
aatctacatggcctattgccagaagcggttgaaaccattgaagagcaagcagagcgggct
taccgccagtatcaggattttaaaaacgacgacgataagcatatttatctgcgcaatatt
caggataccaatgaaacgctgttttatcgtctgctagaagctcacctaagtgagatgatg
ccaattatctacaccccaaccgttggggaagcgtgtgagcacttttctgatatttatcgc
cgtgcacgcgggttatttatttcctatccgaaccgcgaacacattgatgacatgctacaa
aatgccaccaaacaaaatgttaaggttatcgtcgtcactgatggcgagcgtattctgggc
cttggcgaccaaggtatcggcggtatgggtatcccaataggtaaattatcgttgtatacc
gcatgcggcggcattagcccagcctacacgttgcccgtagtacttgatgtcgggacaaat
aacccacaacggttgaatgacccactgtatatgggctggcgtcatccacgaatctccggt
gacgagtactatgcatttgttgatgaatttattcaggcggtaaaacgtcgttggccaaat
gtcttgttgcagtttgaagattttgcacagaaaaatgccaccccgctgctaaaccgctat
cgcgatgaattatgctgtttcaatgatgatatacaagggaccgcggcagtcactctgggt
agcctgattgccgccagccatgctgcgggtagccaactgcgcgaccaaacagtcaccttc
cttggtgctggttccgcgggttgtggtattgccgagcagatcatcgctcaaatgatgtca
gagggcttaagcgaaatacaagctcgagcgcggatctttatggtcgaccggtttggtctg
ctgacagataaactgcctaacttgctcgatttccaaagtaaattggtacaaaaaagtgac
gacctacaccactggaatctgcacaatgatgcgatttcattacttgatgttgtccgtaat
gccaaaccaaccgtactcattggggtttcaggtcaaccagggctgtttactgaagagttg
atccgtgaaatgcacagccattgcgcccggcctatcgtcatgccattgtctaacccaaca
tcacgggttgaagcccgaccagaagatattatcaactggaccgatggcgcggcactggtt
gccacaggtagcccattcccaccagtcagttataaagaaaaactgtatcctattgctcaa
tgtaataactcttacatcttccccggtatcggcttgggtgtattggcatctggtgcgagc
cgtgtcacggatggcatgttaatggctgccagccgggcattagcagagagctcaccactc
gcacgtcatggcgaaggggccttactgcctaatatcgatgatattcaggcggtatcgaaa
gctatcgcaatgcgggtcggtcaagccgctcaattacaaggtgttgctattgtgacttcg
gaagaagcgttgtctaaagccattgagcacaattattggcaaccacagtaccgtagctat
aaacgcacctcgttttga

DBGET integrated database retrieval system