Yersinia pseudotuberculosis EP2/+: BZ20_1084 Help Entry BZ20_1084         CDS       T03678                                  Symbol hupB Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism ypr  Yersinia pseudotuberculosis EP2/+ Brite KEGG Orthology (KO) [BR:ypr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ypr03032]     BZ20_1084 (hupB)    03036 Chromosome and associated proteins [BR:ypr03036]     BZ20_1084 (hupB)    03400 DNA repair and recombination proteins [BR:ypr03400]     BZ20_1084 (hupB) DNA replication proteins [BR:ypr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BZ20_1084 (hupB) Chromosome and associated proteins [BR:ypr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BZ20_1084 (hupB) DNA repair and recombination proteins [BR:ypr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BZ20_1084 (hupB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 SeleniumBinding Motif Other DBs NCBI-ProteinID:  AJJ06885 UniProt:  A0A0T9MXU2 LinkDB All DBs Position complement(1202045..1202317) Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDAIITSVTESLKEGDDVALVGFGTFAVRERSARTG RNPQTGKEISIPAAKVPGFRAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataagtcacaactgatagacaaaattgccgcaggtgctgatatttctaaagcggcc gctgggcgtgcgttagatgcaattattacttctgttactgaatccttgaaagaaggggat gatgtggctctggttggttttggtacttttgcagtacgtgagcgttctgcacgtactggc cgtaacccgcagacaggtaaagaaattagtattccagccgctaaagtaccgggttttcgt gccggtaaaggcctgaaagacgcagtaaactga

DBGET integrated database retrieval system