KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_1277Help
Entry
BZ20_1277         CDS       T03678                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BZ20_1277
Enzymes [BR:ypr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BZ20_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 IpgD FAM72
Motif
Other DBs
NCBI-ProteinID: AJJ06590
UniProt: A0A3G5KF75
LinkDB All DBs
Position
complement(1425579..1426694)
Genome map
AA seq 371 aa AA seqDB search
MSHENLKGAQMAEGIPETMRAVVAYGPRDYRFERVPVPTIDAKEILVKVEGCGICAGDTK
AFEGAPSFWGDDKQPAYIKAPMIPGHEFIGHVVGLGADVEGFELGDRVTSEQIVPCWGCR
FCNHGQYWMCEKHDLYGFQSNVNGAMAEYLKFTKEAINYHVPDHLPLEKAILIEPYACAF
HAVQRAKIKLGDVVVLAGSGTLGLGMIGAIKKSGAAKLIVLDLSDDRLALAKKFGADLVL
NPSRDDVNTLIKEMTGGYGCDIYIDATGAQKAVEQGLTLLRKLGTFVEFSVFKDPVTVDW
SIISDRKELDVLGSHLGPYCFPLVIEGISNGDLPTEGVVTHILPLEKYAEGIELVKRGVD
SLKVVLNPNLT
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgaaaaccttaaaggcgctcaaatggcggagggtatccccgagaccatgcgt
gcagttgtcgcctacgggccgcgcgattatcggtttgaaagagtgccggttccgactatc
gatgccaaagagattttggtcaaagttgaagggtgtggcatctgcgccggggacaccaag
gcttttgagggtgcccccagtttctggggtgatgataagcaacctgcttatatcaaagca
ccgatgattccaggtcatgaatttattggtcacgtcgttggcttgggcgcagatgttgag
gggtttgagctaggtgatagagtgacttctgagcaaattgttccttgctggggctgccgg
ttctgtaaccatgggcagtactggatgtgtgaaaaacacgatctgtacggcttccagagc
aatgttaatggcgcgatggctgaatacctgaaattcacgaaagaagcgattaattatcat
gtccctgatcaccttcctttagaaaaagccattctgattgaaccctatgcctgcgcattt
cacgcggtacaacgcgccaagataaaactcggtgatgtggtggttttggccggttcagga
accttagggctaggcatgattggggcaattaaaaagtctggggctgccaagctcattgtg
ctggatttatcggatgatcgtttggctctcgccaagaagttcggcgctgatttggtgctt
aatcccagtagagatgatgtgaataccctgattaaagaaatgaccggtggttatggttgc
gatatctacattgatgccactggtgcgcaaaaagccgttgaacaaggattaaccctgctg
cgtaagttggggacgtttgtggaattctcggtatttaaagatcccgtgaccgttgactgg
agcatcatcagtgaccgtaaggaacttgatgtcttgggttcacatctggggccatattgc
ttcccgctggtgattgaaggcatctctaacggtgatttaccgaccgagggggtcgtcaca
catatcttgccattggagaaatatgccgagggtattgagctggtcaaaagaggcgttgac
tcacttaaagtggttctcaatcccaacctaacctaa

DBGET integrated database retrieval system