KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_1802Help
Entry
BZ20_1802         CDS       T03678                                 

Definition
(GenBank) dicarboxylate symporter family protein
  KO
K11102  proton glutamate symport protein
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypr02000]
    BZ20_1802
Transporters [BR:ypr02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BZ20_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDF PRF
Motif
Other DBs
NCBI-ProteinID: AJJ07372
UniProt: A0A3G5ISC4
LinkDB All DBs
Position
complement(2025827..2027143)
Genome map
AA seq 438 aa AA seqDB search
MKSIKISLAWQILIALVLGILVGAVLHNQIESREWLVSNILSPAGDIFIRLIKMIVVPIV
ISTLIVGIAGVGDAKKLGRIGLKTIIYFEVITTIAIIIGITLANVFQPGVGIDMSALTVV
DISQYEKTTEQVQSGSHSLVSTILSLIPANVFASMAKGDMLPIIFFSVLFGLGLSSLPKE
TKEPLLNVFKAVSESMFKVTHMIMRYAPIGVFGLISVTVANFGFASLIPLAKLVILVYAA
ILFFALVILGTVARLCKLRIWILIRILKDELILAYSTASSETVLPRIIEKMEAYGAPKAI
TSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIELSIGQEIILVLTLMVTSKGIAGVPGV
SFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWENQFDDKKA
KAYEKALFAAEQTPANQS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtataaaaataagtctggcatggcaaatactcattgcactggtgttaggcatt
ttggttggcgcagttttacataatcaaattgaatccagggaatggttagttagtaatatt
ctgagtccagcgggcgatatatttatccgcttaattaaaatgattgttgtaccgattgtt
atttcaacgttaattgtcggtattgcgggggtcggtgatgcgaagaaacttggccggatt
ggcctaaaaaccattatctactttgaagttatcaccacgattgccattattatcggtatc
actctggcgaatgtattccagccgggggtgggtatagatatgtctgcgctaaccgtcgtt
gatatctctcagtatgaaaaaaccactgaacaggtgcaaagcggtagtcatagtctggtt
agcactatcttgtcgctgatcccggccaatgtctttgcctcaatggcgaaaggcgatatg
ttgccgattattttcttctcagtgttgtttggtttagggctgtcttcattgccaaaagaa
accaaagaaccactgttgaatgtgttcaaggctgtttctgaaagcatgttcaaagtcact
cacatgattatgcgttatgcgcctatcggggtgtttggcttgatctcggtgactgtggct
aactttggttttgcctcactaatccctctcgcgaagttagttattctggtttatgccgcg
atcctgttctttgctttagttattctgggaacggtagcgagattatgtaagctgcggatc
tggatattgattcgtattttgaaagatgaactgattttggcgtattccactgccagttct
gagacagtcttaccgcgtattattgagaaaatggaagcttatggagcaccaaaagcgatt
accagctttgtggttccaacgggttattcattcaacttagatggctcgacattatatcag
agcattgcggctatcttcattgcacagttatacggaatcgaattgtctattgggcaagag
attattttggttctgacattgatggtgacctcgaaagggattgctggtgtaccaggcgtc
tccttcgtcgtattactggcaacgttgggcagtgtgggtattccattggaaggtctggcc
ttcattgccggtgttgaccgtattctggatatggcccgtaccgcgttgaatgtggtgggt
aatgcattggcagtattggtgatcgccaaatgggaaaatcagtttgacgataaaaaagcc
aaggcttatgaaaaagcgttgtttgcagcagagcagacgccagctaatcaaagctaa

DBGET integrated database retrieval system