KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_2286Help
Entry
BZ20_2286         CDS       T03678                                 

Definition
(GenBank) ABC transporter family protein
  KO
K10441  ribose transport system ATP-binding protein [EC:7.5.2.7]
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BZ20_2286
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypr02000]
    BZ20_2286
Enzymes [BR:ypr01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.7  ABC-type D-ribose transporter
     BZ20_2286
Transporters [BR:ypr02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    BZ20_2286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_30 RsgA_GTPase SMC_N AAA_23 AAA_29 AAA_27 TsaE AAA_25
Motif
Other DBs
NCBI-ProteinID: AJJ07114
UniProt: A0A3G5JDR8
LinkDB All DBs
Position
2581260..2582783
Genome map
AA seq 507 aa AA seqDB search
MNKVPLLEMRNITKSFGKFQALKGVDLTVFSGEIHALMGENGAGKSTLMKILAGAYTTTS
GEILIEGRPWSIKGPKDALNAGISLIYQEMQLAPNLTVAENIFLGSELSRGGLVQRKEMV
MQTQAVIDRLGAQFKASDLVMGLTIAEQQQVEIARALHRNSRILVMDEPTAALSTRETHR
LFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQYVGSLMRANLNANELVRMMVG
RPLSDLFNKERDIPLGHLRLNVHHLTDGAKVQAVSLQVRSGEIVGLAGLVGAGRSELAQL
IFGVRKATGGTIEIDGVPLVIHSPREAIRHGIGFLTENRKEQGLFLELAAQDNITMATLE
RDACYGLLDRKKARAISDDAINRLNIRVPHAQVRAGGLSGGNQQKLLISRWVAISPRILI
LDEPTRGVDVGAKSEIYRIMSQMAREGVAILMISSELPEVVGMSDRVYVMHEGRIAGELH
HPDITQENIMTLATGVTEDHKKEVYHD
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtccccctcttggagatgcgtaatattaccaagtcgtttggcaaatttcag
gcgcttaaaggtgtcgatttgacggtgttttccggcgagatccacgcgctgatgggcgaa
aacggggcggggaaaagtaccctaatgaagatcctcgctggcgcatataccaccaccagc
ggcgagatccttattgagggtaggccttggtccatcaaaggcccaaaagatgcgctgaat
gcaggtattagtttgatttaccaagagatgcagctcgcacctaacctgaccgttgcggaa
aatattttccttggcagcgagctttcccggggagggctggtgcagcgtaaagagatggtg
atgcagacccaggcggttatcgaccgcctcggcgctcagtttaaagccagcgatttagtg
atggggcttaccatcgccgaacaacagcaggtcgagattgctcgtgcacttcatcgtaac
agccgcattttggtgatggatgaacccacagcggcgctttctactcgtgaaacgcatcgc
ctatttgaacttattttgcggctgcgcgatgaggggatggccattatctacatcagccat
cgtatggcggaagtgtatgaactttctgaccgtgtgagcgtactgcgcgacgggcaatac
gtcggcagcctgatgcgcgccaacctcaacgccaacgaactggtgcgcatgatggtgggg
cgtccgcttagcgatctgttcaataaagaacgggatattccactcggtcatttacgcctt
aatgttcatcacctgacggatggtgccaaagtgcaggcggtgagtttacaggtccgttcc
ggtgaaatcgttgggttagcggggttggtgggcgcagggcgttcggagctggcgcaactg
atttttggtgtccgcaaagccaccggaggaacgatagagatagatggcgtaccgttggtc
attcactcccctcgtgaagccattcgccacggtattggttttctgaccgagaaccgcaaa
gagcaagggctgtttttggaactggccgcgcaggacaacatcactatggcaaccctggag
cgggacgcctgttacggcctgctcgatcgcaaaaaagcccgtgccatttcagacgacgcc
atcaatcggttgaacatacgtgtacctcatgcgcaggtgcgtgccggaggcttgtccggg
ggtaaccagcaaaagctgctgatttcccgttgggtagcgattagcccacgcattcttatc
cttgatgagccaacacgtggagtggacgtcggcgctaaaagcgagatttaccgcatcatg
agccagatggcgcgcgagggggtggcgattttgatgatttccagtgagttgcccgaggtg
gtagggatgagcgaccgggtgtacgtgatgcatgaaggacgtattgcaggggaactacat
caccctgatatcacgcaggaaaatattatgacgctggcaactggcgtgaccgaggaccat
aaaaaagaggtttaccatgactaa

DBGET integrated database retrieval system