KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_2288Help
Entry
BZ20_2288         CDS       T03678                                 

Definition
(GenBank) periplasmic binding domain protein
  KO
K10439  ribose transport system substrate-binding protein
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr02010  ABC transporters
ypr02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BZ20_2288
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BZ20_2288
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypr02000]
    BZ20_2288
Transporters [BR:ypr02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    BZ20_2288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: AJJ07962
UniProt: A0A3G5IU49
LinkDB All DBs
Position
2583799..2584743
Genome map
AA seq 314 aa AA seqDB search
MRLKPIMTALIAGAMIASSPALQAKELNSIGVTVGDLANPFFVQITKGVELEARKLAGDK
VKVTLVSSGYDLGQQVAQIDNFIAAKVDMIILNAADSKGIGPAVKRAKDAGIVVVAVDVA
AEGADATITSDNTQAGAMACKYISDRLKEKGNVVIINGPPVSAIQNRVEGCESEFKKYPD
IKVLSSNQNAKGSREGGLEVMTSLLAVNPKIDGVFAINDPTAIGADLAAKQAQRNEFFIV
GVDGSPDAEEALKRGGNTLFVATPAQDPQVMASKAVEVGYGILQGNPAPKDPILIPVTLI
DKNNISTYKGWTMK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgaaacccataatgaccgcactaatcgcgggggccatgatagccagttcaccg
gcgctccaggcgaaagagttgaactcgataggcgtaacggtgggcgatcttgccaaccca
tttttcgtgcaaatcaccaaaggtgtggagttagaagcgcgtaagttggccggcgataaa
gtcaaagttacgctcgtttccagcggctacgatctcggccagcaggtggcacagatagat
aactttattgccgccaaagtggacatgatcattctcaatgccgcggattctaaagggatc
ggtccggcggtgaagcgtgctaaagatgccggtattgtcgtggtggcagtggatgtggca
gcagaaggggctgacgcaacgattacctctgacaacactcaggccggtgcgatggcgtgt
aagtacatatccgaccgtctgaaagagaaaggcaacgtggttattatcaacgggccgcca
gtgtctgccatacaaaaccgtgttgaaggttgtgaaagcgaattcaaaaaatatcctgat
atcaaggtcctttcttctaaccaaaatgctaagggcagtcgagaaggtggcctggaggtg
atgacctctttgctggcggtgaacccgaagatcgatggcgtgtttgccatcaatgatcca
acggcgattggggctgatttggctgccaaacaggcacaacgtaatgaattctttattgtt
ggcgtggacggcagcccggatgcagaagaagcgctgaaacgggggggtaacacattgttt
gtcgcgaccccagcgcaagatcctcaggtcatggcctccaaagccgttgaggttggttat
ggcatcttgcagggcaacccagcaccaaaagatcccattttgataccagtgaccctgatc
gacaaaaataatatcagcacttacaaaggctggacgatgaaataa

DBGET integrated database retrieval system