KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_2290Help
Entry
BZ20_2290         CDS       T03678                                 

Definition
(GenBank) ketose-bisphosphate aldolase family protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr00010  Glycolysis / Gluconeogenesis
ypr00030  Pentose phosphate pathway
ypr00051  Fructose and mannose metabolism
ypr00680  Methane metabolism
ypr01100  Metabolic pathways
ypr01110  Biosynthesis of secondary metabolites
ypr01120  Microbial metabolism in diverse environments
ypr01200  Carbon metabolism
ypr01230  Biosynthesis of amino acids
Module
ypr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZ20_2290
   00030 Pentose phosphate pathway
    BZ20_2290
   00051 Fructose and mannose metabolism
    BZ20_2290
  09102 Energy metabolism
   00680 Methane metabolism
    BZ20_2290
Enzymes [BR:ypr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BZ20_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase FMN_dh
Motif
Other DBs
NCBI-ProteinID: AJJ07725
UniProt: A0A3G5KJL9
LinkDB All DBs
Position
2585527..2586387
Genome map
AA seq 286 aa AA seqDB search
MALISLANGLAHARKNGYALGAFNVLDSHFLRALFAAAKQERSPFIINIAEVHFKYLSLE
SLVEAVKFEAAHHDIPVVLNLDHGLHFEAVVRALRLGFSSVMFDGSTLEYEENVRQTREV
VKMCHAVGVSVEAELGAVGGDEGGALYGEADSNKFTDPAIARDFVDRTGIDALAVAIGNA
HGKYKGEPKLDFARLAAIHQQTGLPLVLHGGSGISDTDFRRAISLGIHKINFYTGMSQAA
LAAVEQKMTHRHAIYDEFAELFLGIEEAITDVVAQQMRIFGSSEQI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggctttgatttcccttgcaaatggcctggctcatgccaggaaaaacggttacgcattg
ggtgcctttaacgtgctcgatagccactttttgcgcgccctgtttgccgctgcaaaacag
gaacgatcgccgtttatcatcaatattgctgaagtccattttaagtacctttcgctagaa
tcattggtagaagcagtgaaattcgaagctgcacaccatgatatcccggtggtgcttaat
ctcgaccacggcctgcactttgaagccgtggtccgcgcactcaggctgggttttagttcg
gtaatgtttgatggttccacacttgaatatgaagaaaacgttcgccagacccgtgaagtt
gtgaagatgtgccatgccgtgggtgtatcggtggaagctgaactgggcgctgttggcggt
gatgaaggcggtgcgctttatggtgaagctgatagcaataaattcaccgatcccgccatc
gcccgggactttgttgaccgtaccggtatcgatgccttagcggtcgccatcggcaacgca
cacggcaagtataaaggtgaacccaagctcgacttcgcgcgtctggccgccattcatcag
caaaccggcctacctctggtactgcacggtggctctgggatcagcgataccgatttccgg
cgggctatcagccttggcattcataaaatcaatttttataccggcatgtcgcaggcagcg
ctggctgccgtggaacagaaaatgactcatcgacacgctatttatgacgagttcgccgag
ttgttcctggggatcgaggaggctattactgatgtcgtagcgcaacaaatgcgaattttc
ggcagttcagagcaaatctga

DBGET integrated database retrieval system