KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_2291Help
Entry
BZ20_2291         CDS       T03678                                 

Definition
(GenBank) pfkB carbohydrate kinase family protein
Organism
ypr  Yersinia pseudotuberculosis EP2/+
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AJJ06199
UniProt: A0A3G5KMV3
LinkDB All DBs
Position
2586397..2587404
Genome map
AA seq 335 aa AA seqDB search
MIERNGIIAAGNMLVDHVHQIEQWPQRGWLAEIVHSERSTGGAPLNVLLTLAKMYTGLPL
QAVGLIGDDHDGDYIMAMLDQYQVNRQHVRRTTLAPTSMSQVMTDPSGQRTFFHSPGTNR
LLDLPAFDGLDTSFKIFHLGYLLLLDSLDVEDTEYGTRSARLLALMSQLGYETSLDLVSR
EGDPRYHLLVTPTLCWLDYLTINELEAGELSGLEMRLADGTPDVHHIAQAAKQLLEAGVR
QRVVIHCPEGAWGVDHGQEGVWVPSWKLAQEEIVGSVGAGDAFCAGILYGYHERWPLTDC
IQLAHACARANLLCANAIDGAKPLAELDVFIRENR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacgcaacgggattattgccgccggtaatatgttggtcgaccatgttcatcaa
attgagcaatggccgcagcgtggttggctggcggaaatcgtacacagcgagcgctcaacc
ggcggcgcaccgcttaacgtattgctgacgctggccaaaatgtataccgggctgccgctg
caggcggtgggccttattggcgatgatcatgacggtgattacattatggcgatgctcgac
cagtatcaggtcaatcgccaacacgttcggcggaccaccttggctccaacatctatgtca
caagtcatgaccgatccgagcggccagcgcacctttttccactctccaggcaccaaccgc
ctgctcgacttgcccgctttcgatggccttgatacatcatttaaaattttccatcttggc
tatctgctgttgctcgatagtttggatgtggaagacaccgagtacggtactcgtagcgcc
agactactggcgctgatgtcgcagcttggttatgaaacctccctcgacttagtgtcaaga
gaaggcgatcctcgttatcatttactggtgacgccaacgttgtgctggctggattatctg
accattaatgaactggaggctggcgagttaagcgggctggagatgcgtcttgccgatggc
accccggacgtccatcatatcgctcaggcggcaaaacaattacttgaagccggcgtgcgt
cagcgggtggtgattcactgcccggaaggtgcatggggcgtagatcatgggcaggagggg
gtatgggtgccttcgtggaaactggcccaggaagagatagtcggtagcgttggtgccggg
gatgccttttgcgctggcatattatatggctaccatgaacgctggccgttaactgattgt
attcaattagcccacgcctgcgcccgtgccaatttactttgtgccaatgctattgatggt
gcaaagccactggcggaattagacgtgtttattcgtgagaaccgttaa

DBGET integrated database retrieval system