KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_2292Help
Entry
BZ20_2292         CDS       T03678                                 

Definition
(GenBank) hypothetical protein
Organism
ypr  Yersinia pseudotuberculosis EP2/+
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C ThiG OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AJJ05133
UniProt: A0A2A7VLQ1
LinkDB All DBs
Position
complement(2587479..2588216)
Genome map
AA seq 245 aa AA seqDB search
MKPAILVVDDDTAICEVLRDVLNEHVFDVLLCHSGNEALQITATQPSIALILLDMMLPDI
NGLLVLQQVQKLRPSLPVVMLTGMGSESDMVVGLEMGADDYIAKPFNARVVVARVKAVLR
RSEVLAIESSSVIESSSVKACGLQFNGWRLNTDRCQLMNPQQQQIDLTQGEYGLLLSLMQ
NARKVLSREKLLELTHRESLDVFDRTIDVLIMRLRRKIEVNPHQPTLIRTIRGVGYVFAA
DIIHA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgcaatcctcgtggtggatgacgatacggccatctgtgaagtgctgcgagat
gtacttaacgaacacgtattcgatgtactgttatgccacagcggcaatgaggcgcttcag
attaccgctacacagccctcaatcgcacttattttgcttgatatgatgctgccggatatc
aatggcctgttggtgttgcagcaagtgcaaaaactgcgcccgtcgctaccggtcgtgatg
ctcaccggcatgggtagtgagtctgatatggtggttgggctagaaatgggggcggacgac
tatatcgctaaaccatttaatgccagggtagtggtcgcacgcgttaaagcggtgttgcgg
cggagcgaggtgttggcgatagaaagtagcagtgtgatagaaagtagcagtgtgaaagcc
tgcggattgcaatttaatggctggcggctgaataccgaccgctgtcagttgatgaaccca
cagcagcagcaaatcgatttgactcagggggaatatggcctgctgctgtcgttgatgcaa
aacgccagaaaagtgctctctcgtgaaaagctgcttgaactgacgcaccgtgaaagcctg
gacgtttttgatcgcactattgatgtactgattatgcggttacgtcgaaaaatagaagtt
aatccgcaccagcccacactgatccgtaccatccgcggcgtggggtatgtctttgccgcc
gatattattcatgcctag

DBGET integrated database retrieval system