KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_257Help
Entry
BZ20_257          CDS       T03678                                 

Definition
(GenBank) bacterial extracellular solute-binding s, 3 family protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BZ20_257
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypr02000]
    BZ20_257
   02035 Bacterial motility proteins [BR:ypr02035]
    BZ20_257
Transporters [BR:ypr02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    BZ20_257
Bacterial motility proteins [BR:ypr02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BZ20_257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 PetG
Motif
Other DBs
NCBI-ProteinID: AJJ05650
UniProt: A0A3G5KI67
LinkDB All DBs
Position
complement(281973..282773)
Genome map
AA seq 266 aa AA seqDB search
MSFSIVRRRIVLGMVAVALATGLNVKSYAAGDLLEQVKQRGTLIVGLEGTYPPFSFQGED
GKLTGFEVDFANALAEHMGVKAKITPTKWDGMLASLESKRIDVAINQVTISDERKKKYDF
STPYTVSGIQVLTKKGNEGQFTKPEDLQGKKVGVGLGSNYEQWLRENLKDVDIRTYDDDP
TKYQDLRVGRTDAILVDRLAALDLVKKTNDALAVAGPAFARQESGVAMRKNNPELLAAVN
NAIAEMQKDGTLAKISEKYFGADVTQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttcaattgtacgtcgccgcattgttctgggcatggtggcggtcgcactggca
accggcttgaacgtgaagtcttacgctgctggtgacctgttggagcaggttaaacaacgc
ggcaccctgattgttgggttagaggggacttatccgccgttcagttttcagggcgaggat
ggcaaactcactggttttgaagtggattttgccaacgcattggctgaacacatgggggtc
aaagctaaaatcacgccaaccaaatgggatgggatgctggcctcgctggagtctaaacgt
attgatgtggccattaaccaggtcactatctcagatgaacgtaagaaaaaatatgacttc
tcaacaccttataccgtttctggtattcaagtactgaccaaaaaaggtaacgaaggccag
tttactaagccagaagatttacagggtaagaaggttggcgtgggtttaggcagtaactat
gagcagtggttacgtgaaaacctgaaagacgttgatattcgcacctatgatgatgaccca
acgaaatatcaggatctgcgtgttggccgtaccgacgccattttggttgaccgcttagcg
gcattggatttggtgaagaaaactaacgatgcactggcggtggctggccccgcgtttgca
cgccaagaatcgggtgtggcgatgcgcaaaaataaccctgaattgttagccgcagtcaat
aatgctattgctgagatgcaaaaagacggcacgctagccaagatttctgagaaatacttt
ggtgcggacgtgactcaataa

DBGET integrated database retrieval system