Yersinia pseudotuberculosis EP2/+: BZ20_2586 Help Entry BZ20_2586         CDS       T03678                                  Symbol ptsO Name (GenBank) phosphocarrier protein NPr   KO K08485   phosphocarrier protein NPr Organism ypr  Yersinia pseudotuberculosis EP2/+ Pathway ypr02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:ypr00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     BZ20_2586 (ptsO)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ypr02000]     BZ20_2586 (ptsO) Transporters [BR:ypr02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     BZ20_2586 (ptsO) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  AJJ08031 UniProt:  A0A0T9JFS9 LinkDB All DBs Position complement(2925316..2925588) Genome browser AA seq 90 aa AA seqDB search MTVKQTVEIKNKLGMHARPAMKLFELVQSFDAEVMLRNDSGTEAEASSVIALLMLDSAKG RQIEVEATGVDEIQALAAVIELFNSGFDED NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgactgtcaaacaaaccgttgagatcaaaaacaagctgggaatgcacgccagacccgcg atgaaattgttcgagctggttcagagttttgatgcagaagtgatgttacgcaatgacagc ggtaccgaagcggaggccagcagcgtcattgcgctgctgatgctggattcagccaaaggc cgccaaatagaggttgaagcaaccggggttgatgaaattcaggcattggcagcggttatc gagttgtttaattcgggatttgacgaagattaa

DBGET integrated database retrieval system