KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_3546
Entry
BZ20_3546         CDS       T03678                                 

Definition
(GenBank) type VI secretion lipofamily protein
  KO
K11906  type VI secretion system protein VasD
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BZ20_3546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypr02044]
    BZ20_3546
Secretion system [BR:ypr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BZ20_3546
SSDB
Motif
Pfam: T6SS-SciN DUF4969
Other DBs
NCBI-ProteinID: AJJ07587
UniProt: A0A3G5KK48
LinkDB
Position
4026359..4026898
AA seq 179 aa
MNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPL
RIALYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAI
GIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
NT seq 540 nt   +upstreamnt  +downstreamnt
atgaataaaagtatccgaggggtttaccgggcgacacagtacttatttttggtactggta
acgttattgacgatagcctgtagttcaaaagtgcaacctgaaaaggctgaaaaacttacc
gtcgaaatcgcgacagcagcggatattaatccgaatgataaaggggtggcgaacccgcta
aggattgcgctttatacactcaagagcaccgatgaatttcagtcgagtgatttcttcact
atcactgaagaaaatacgccatcgctaaaagaacaaatggataacgtgtttgaccggatt
atgttgccaagcgagaccaaaaaaatagagctgacacttgatgctggcgttactgctatc
ggcatcgtggctgcttatcgtgaaattgaacaggcggagtggaaagcggttatttatccg
ttgcccaaaaagcgcgtggatccttggtataaaaaaatgtggccagggcaagaccaacaa
gatccgatcatgaaggtacgcgttgagcgtctgtcaatatcaattaaagaaatggattaa

DBGET integrated database retrieval system