KEGG   Yersinia pseudotuberculosis EP2/+: BZ20_3773Help
Entry
BZ20_3773         CDS       T03678                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ypr  Yersinia pseudotuberculosis EP2/+
Pathway
ypr00020  Citrate cycle (TCA cycle)
ypr00480  Glutathione metabolism
ypr01100  Metabolic pathways
ypr01110  Biosynthesis of secondary metabolites
ypr01120  Microbial metabolism in diverse environments
ypr01130  Biosynthesis of antibiotics
ypr01200  Carbon metabolism
ypr01210  2-Oxocarboxylic acid metabolism
ypr01230  Biosynthesis of amino acids
Module
ypr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ypr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BZ20_3773 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BZ20_3773 (icd)
Enzymes [BR:ypr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BZ20_3773 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AJJ07992
UniProt: A0A2P6YDC1
LinkDB All DBs
Position
4297278..4298531
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKEIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgacggtattggtgtt
gatgtaaccccggcgatgatcaacgtggtagatgctgcggttaagaaagcttataacggt
gaacgtaaaatttcctggatggaaatttacactggtgagaaatcaacccatgtctatggt
aaagatgtttggttgccagaagaaaccttagatctgatccgtgattatcgcgttgctatc
aaaggcccgttgaccactcctgtcggtggcggcatccgttctttgaacgttgctctgcgt
caacaacttgacctgtatgtgtgtctgcgtccggtgcgttattatgaaggcaccccaagc
ccggtaaaacaccctgaactgaccaacatggtaattttccgtgaaaacgctgaagatatc
tatgcgggtatcgaatggaaagcgggttcacccgaagcagagaaagtgatcaagttcctg
cgtgaagagatgggtgtgaagaaaatccgtttccctgaacaatgtggtatcggtgtgaaa
ccgtgttcagaagaagggactaagcgtttggtacgtgcagcgattgaatatgcaattacc
aacgatcgtgaatcagttacgctggttcataaaggcaacattatgaaattcaccgaaggc
gcgtttaaagactggggttatcagttagcgcgtgaggaatttggtggtgaactgatcgac
ggtggcccatgggttaaaatcaaaaacccaaataacggcaaagaaattatcgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgtcctgcggaatatgatgttatc
gcttgtatgaacctgaacggtgattacatctctgatgcattggcagctcaggttggcggt
attggtattgctccgggggctaacattggtgatgactgcgcactgttcgaagccactcac
ggtactgcaccaaaatatgctggtcaggataaagtgaacccaggttctattattctttca
gcagaaatgatgctgcgtcacatgggctggtttgaagccgctgacttaatcattaaaggc
actgaaggcgcaattcaagccaagaccgtgacttatgatttcgaacgtctgatggaaggc
gctaagttgttgaagtgtagtgagtttggcgacgccattattaagcacatgtaa

DBGET integrated database retrieval system