KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB0108Help
Entry
YPTB0108          CDS       T00195                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00620  Pyruvate metabolism
yps00680  Methane metabolism
yps01100  Metabolic pathways
yps01120  Microbial metabolism in diverse environments
yps01200  Carbon metabolism
Module
yps_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:yps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YPTB0108 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    YPTB0108 (ppc)
Enzymes [BR:yps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     YPTB0108 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAH19348
UniProt: Q66G74
LinkDB All DBs
Position
complement(123720..126356)
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFTRLKDKKLSDQD
MRSAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLENSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRE
LAGGEEVLEPYRQLMKNVRTQLTNTQAYLEARLKGERVLPPHDLLVSNDQLWEPLYACYQ
SLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYESW
SESDKQAFLVRELNSKRPLVPLKWEPSAETQEVLETCRVIAEAPQGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVMTQLLGIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGITLTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAILEANLLPPPEPKKEWIEVMDLLS
DASCDMYRSYVRENPEFVRYFRAATPELELGKLPLGSRPAKRRPDGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQRAIDAGKRDVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLAADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDACVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggcacactactcgga
gacaccatcaaggaagcgttgggagagcatattcttgatagagtagaaaccatccggaaa
ttatccaaatcttcgcgtgcgggtaatgaagcgagccgtcaggaattactgaccacactg
caaaatctttccaacgatgagctactgccggtcgcccgtgcctttagccaattccttaat
ctgacgaatacggcagagcaataccacagtatttcaccacatggtgaagccgcgagtaat
ccggaagccctcgcccaattatttacccgcttaaaagataaaaagctgagcgatcaagat
atgcgcagcgcggttgacgatttgtcgattgagttggtcttgactgcccacccaaccgaa
attacccgccgcaccttgatccataaactggttgaagtgaatacctgcctgagccagttg
gatcacaatgatttagccgattacgaacgcaacaagatcatgcgtcgtttacggcagtta
gttgcacaatcgtggcataccgacgaaattcgcaaactgcgtccctcgcccgttgatgaa
gccaaatggggctttgcggtggtggaaaacagcctgtgggaaggcgtccctgcattcctg
cgtgagtttaacgagcagttagagaactcccttgattaccgtctacccgtggaagcggta
cctattcgctttacttcatggatgggcggtgaccgcgatggtaacccgaatgtaacggct
gaaatcactcgccatgtgctgctactcagccgttggaaagccaccgatttattcctgcgt
gatattcaggtgctggtgtctgaactttctatgtcggaatgtaccccggagctgcgtgaa
ttagccggtggtgaagaggtgcttgaaccttatcgccaactgatgaagaacgttcgtacc
caattgaccaatacccaggcttatctggaagcgcgtctgaaaggcgagcgcgtattgcca
ccacacgatttactggtcagtaatgatcaactgtgggaaccgctctacgcctgctatcaa
tcgctgaaagcctgtggcatggaaatcatcgccaacggtcagttgttggataccctacgc
cgcgtgcgttgttttggtgtgccattggtgcgcattgatgtgcgtcaggaaagtacccgt
cataccgatgctatcgcggagctgacccgttatctgggccttggtgattatgagagttgg
tctgaatcagacaagcaagcctttttggtccgcgaactgaactctaagcgcccactggtt
cctctaaaatgggaacctagcgccgagacacaagaagtgctggaaacctgtcgggtgatt
gctgaagcaccgcaaggttctatcgctgcttacgttatctctatggcgaaagtgccgtca
gacgtgctggccgtgcatttgttactgaaagaagcgggttgcccatttactctacctgtc
gccccgctattcgagaccctcgatgacttgaacaacgctgacgatgtcatgacccagttg
ctgggtatcgattggtatcgtggcctgatccaaggcaagcagatggtgatgattggctat
tctgactcggcaaaagacgccggtgttatggcggcctcttgggcacaataccgggcgcag
gatgcactgattaaaacctgtgagaaagccgggattacgctgacattgttccatggccgt
gggggttctattggtcgtggtggtgcgccagcccatgcagcattgctctctcagcctccg
ggcagtctgaaaggcggcttacgggttaccgaacaaggcgagatgattcgctttaagttt
gggttaccggaagtcaccatcagcagcctggcgctgtacgcaggtgcaattctggaagcc
aatctgttaccgccaccagagccgaagaaagagtggattgaagtgatggatctgctgtca
gacgcctcttgcgacatgtatcgcagctacgttcgtgaaaatccagagttcgtccgttac
ttccgtgctgcgacaccggaattggaacttggcaagctgcctctgggttcccgcccagcc
aaacgccgcccggacggtggagtggaaagtctgcgggcgatcccatggattttcgcctgg
acacaaaaccgtctgatgctccctgcctggttgggtgccggtgcgggtttgcagagagcg
atcgatgcaggtaagcgagatgtactcgccaccatgtgccgtgactggccgttcttctcg
acccgcattggtatgctggagatggtcttcgccaaagccgatttgtggctggcagaatat
tatgatcagcgtttagtggataaatcgctatggccgttaggtcagcagttacgtgaccaa
ctggcagccgatattaaagtggtgttggctatcgccaacgatgaccatttgatggctgac
ttgccatggattgccgaatccatcgcgttgcgtaacgtgtacaccgatccattaaacgta
ctgcaagccgagctgttgcaccgttcacgccagcaagaacaccctgatgcctgtgttgaa
caagcgttgatggtgaccattgccggtgtggctgcggggatgcggaataccggttag

DBGET integrated database retrieval system