KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2082Help
Entry
YPTB2082          CDS       T00195                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00010  Glycolysis / Gluconeogenesis
yps01100  Metabolic pathways
yps01110  Biosynthesis of secondary metabolites
yps01120  Microbial metabolism in diverse environments
yps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPTB2082
Enzymes [BR:yps01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     YPTB2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAH21320
UniProt: Q66AP8
LinkDB All DBs
Position
complement(2453246..2454121)
Genome map
AA seq 291 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQLDELPVVVVSHPKVRAAISLQGAHLLAYQPSGEQPIIW
LSNNTPFKEGIAIRGGVPICWPWFGPTAQPAHGFARILPWTLSAHDENENGVILTFTLED
NDMTRQYWPHAFTLIARFKLGDECEVELESHGDYQAAAALHTYFQIGDISQIKVSGLGEK
YLDKVLKVADVTQQGDLVFNGQTDRVYTQPEAYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSCSMVDMPNDGYKTMVCVETARVNKPLVAAPDAPARLAMTIRSRKNT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtatttactctccctgttgttgaacaaatttctccttatatcagccag
cgtcaactggatgaattgccggtagtggttgtttctcatcctaaggtgcgtgcggcaata
agtttgcagggggcccacttactggcctatcaacccagtggtgagcaacccattatctgg
ctgagcaataacacgccttttaaagaaggtattgcgattcgtggaggggttccaatttgt
tggccttggtttggcccaaccgcacaacctgcccatggttttgcccgcatcttgccatgg
acgctcagtgctcatgatgaaaatgaaaacggcgtcattctgactttcacccttgaagac
aacgacatgacccgccaatactggccacatgccttcaccctgatcgcccgtttcaagttg
ggagatgaatgtgaagttgaactggaatcacacggtgattatcaggctgctgcggcatta
catacctacttccagattggcgatataagccaaattaaagtcagcgggctgggtgagaaa
tatttagataaagtgctgaaagttgccgatgtcactcaacaaggcgatttagtctttaac
ggccaaactgaccgtgtctatacccaacctgaagcctatagtctgataaaagatgccgcg
ctgaaacgaactattgaggtccatcaccatcaccaaagtgatgtggttgcttggaacccc
ggcgctgaattgtcctgcagcatggtagatatgccaaatgatggctataaaacgatggtt
tgcgtagaaaccgcacgagtcaacaagccattggtggctgcgcctgatgcaccagcacgt
ttggcgatgaccatccgtagccgtaaaaacacctaa

DBGET integrated database retrieval system