KEGG   Yersinia pseudotuberculosis IP 32953 (serotype I): YPTB2992Help
Entry
YPTB2992          CDS       T00195                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
yps  Yersinia pseudotuberculosis IP 32953 (serotype I)
Pathway
yps00061  Fatty acid biosynthesis
yps00780  Biotin metabolism
yps01100  Metabolic pathways
yps01212  Fatty acid metabolism
Module
yps_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YPTB2992 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YPTB2992 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yps01004]
    YPTB2992 (fabZ)
Enzymes [BR:yps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     YPTB2992 (fabZ)
Lipid biosynthesis proteins [BR:yps01004]
 Fatty acid synthase
  Component type
   YPTB2992 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT_3 PS-DH 4HBT
Motif
Other DBs
NCBI-ProteinID: CAH22230
UniProt: Q667K0
LinkDB All DBs
Position
complement(3530012..3530542)
Genome map
AA seq 176 aa AA seqDB search
MTTDTHTLHIEEILDLLPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVEFVKE
RRGLTRFTGVAKVDGEIVCTATMMCARSKPAAPAESVVVKPDVVKPDVVNPVVKES
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcatattgaagagattttggatctactcccgcaccgt
tttccgttcttgctggtagaccgtgtccttgattttgaggaaggaaaatttctgcgtgca
gtgaagaacgtctcttttaacgagccatttttccaaggccatttcccaggcaagcccatc
ttccctggtgtgcttatattagaagcgatggcgcaggctacagggattttggcgtttaag
agccgcggtaaactggaaccgggcgagctttattactttgctggtattgatgaagcacgt
tttaagcgcccagtagtgcctggcgatcagatgatcatggaagttgagtttgttaaagaa
cgccgtggcctaacccgttttaccggtgtagctaaagtcgatggcgaaatcgtttgcact
gccaccatgatgtgcgcgcgtagcaaaccagcagcacctgcagaatctgtcgttgtaaaa
ccagatgttgtaaaaccagatgttgtaaatcctgtcgttaaggagtcctga

DBGET integrated database retrieval system