KEGG   Yersinia pestis A1122: A1122_07085Help
Entry
A1122_07085       CDS       T01831                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ypt  Yersinia pestis A1122
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ypt03012]
    A1122_07085
   03029 Mitochondrial biogenesis [BR:ypt03029]
    A1122_07085
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypt04147]
    A1122_07085
Translation factors [BR:ypt03012]
 Eukaryotic Type
  Elongation factors
   A1122_07085
 Prokaryotic Type
   A1122_07085
Mitochondrial biogenesis [BR:ypt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A1122_07085
Exosome [BR:ypt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A1122_07085
  Exosomal proteins of breast cancer cells
   A1122_07085
  Exosomal proteins of colorectal cancer cells
   A1122_07085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Lsm_C cobW
Motif
Other DBs
NCBI-ProteinID: AEL72072
LinkDB All DBs
Position
1550879..1552063
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDAEWEAKIIELAEALDSYIPQPERAIDRPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIIDTIKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVQRGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaagccgcacgttaatgtgggtactattggccac
gttgaccatggtaaaactaccttaactgctgcaatcaccaccgtattggctaaaacctac
ggcggtagtgctcgtgcattcgaccagatcgacaacgctccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatatgatactcctgctcgtcactatgcacacgtt
gactgcccaggtcatgctgactacgttaaaaatatgatcaccggtgctgctcagatggat
ggagcgatcttggttgttgctgcaaccgatggccctatgccgcagactcgtgagcatatc
ctgctgggccgccaggttggtgtcccatacattattgtcttcctgaacaaatgtgacatg
gttgacgatgaagagttgctagagttggttgaaatggaggttcgtgagcttctgtctcaa
tacgatttcccaggcgacgacactccagtcatccgtggttcagcgttgaaagccctggaa
ggtgacgctgagtgggaagctaaaattatcgagttggcagaagctctggatagctatatt
ccgcaaccagaacgcgctattgatagaccattcctattgccaattgaagacgtattctct
atttctggtcgtggtactgtagttactggtcgtgtagaacgtggtattgttaaggtcggc
gaagaagttgaaatcgttggtattatcgatacgattaaaacaacttgtactggcgttgaa
atgttccgcaagctgctggatgaaggccgtgctggtgaaaatgttggtgttctgctgcgt
ggtactaagcgtgacgatgttcagcgtggtcaagtactggcgaaaccaggttctatcaag
ccacacacgaagtttgagtcagaagtttatattctgagcaaagatgaaggcggccgtcat
acaccgttcttcaagggctaccgtcctcagttctacttccgtacaactgacgtgaccggt
accattgagctgccagaaggcgttgaaatggtcatgcctggtgacaacgtaaacatggtt
gttaacctaattgctcctatcgcaatggatgatggtctgcgcttcgcaattcgtgagggt
ggccgtactgttggtgctggcgttgttgctaaagtcattgaataa

DBGET integrated database retrieval system