KEGG   Yersinia pestis A1122: A1122_09675Help
Entry
A1122_09675       CDS       T01831                                 

Definition
(GenBank) amidase
  KO
K22601  oxamate carbamoyltransferase [EC:2.1.3.5]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00230  Purine metabolism
ypt01100  Metabolic pathways
ypt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A1122_09675
Enzymes [BR:ypt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.5  oxamate carbamoyltransferase
     A1122_09675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEL72582
LinkDB All DBs
Position
complement(2127902..2129299)
Genome map
AA seq 465 aa AA seqDB search
MKPASSLTISEIQQALHKGELSAQAIAQQTLDAITVANPLINAYTHITADRMLSEACRLD
TLRAKGQPLPALAAVPYAVKNLFDVAGETTLSGASLFCDQAPAKQDAWAISCLSRQGAML
SGMLNMDAYAYGFTTENSHYGATHNPHDLNRIAGGSSGGSAAAVAAGLVHFSLGSDTNGS
IRVPSSLCGIFGLKPTFGRLSRRGTHPFVASLDHIGPMARCTQDLAVVYDVMQGIDTQDN
FQADQPVTPCQNLLTRGQQGLRSAVLGGYFHQWSDDDAKAAVLAVAKALEANAEVEMPQS
DLARSAAFIISASEGGNQYLPALRKSPQRFEPLSRERLLAGAMLPATWYVQAQRFRHHFR
QHILPLFEHWDILIAPATPCSATLIGQDTMRINDMDLPIRASMGILTQPISFLGLPVVSV
PLKTTRGLPIGIQLIAPPWREDLCLRAAYALEQQGLVSAPVSTVI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgcctcatcactcactatcagcgagatccaacaagccctgcacaagggcgaa
ttatccgcacaagcgatcgcacagcagacgttggacgccattaccgtcgccaatccgctc
atcaacgcttatacccatatcaccgctgaccgtatgcttagcgaagcttgtcggctagat
acgctacgcgccaaaggccagccgctgccagcactggcggcagtcccttatgcggtcaag
aatctgttcgatgttgccggagaaacaaccctatcaggtgccagcttattttgtgatcaa
gcccccgccaaacaggatgcctgggccatttcatgcctgagccgccaaggagccatgctc
tccggcatgttaaatatggatgcctatgcttacggttttactaccgagaacagccattat
ggtgccacccataatccacacgatctgaaccgcattgcagggggatcttctggcggatct
gcggcagcggtcgccgcagggctcgtgcacttttctctcggcagtgatactaacggttcg
atccgggttccctcctcactgtgtggtatttttgggctgaaaccaacctttggccgcctg
tcacgccgcggcacccacccatttgtcgccagtctggaccatatcggcccaatggcacgc
tgtacgcaagatttggcggtggtttatgacgtgatgcaaggcatcgatactcaggataat
tttcaagccgatcaacccgtcacgccgtgccaaaatttactgacgcgtggtcagcaaggg
ttaagaagcgcggtgctgggcggttactttcatcaatggagtgatgatgacgccaaagcc
gcagtgctggcggtcgcaaaggcgcttgaggctaacgcggaggtcgagatgccgcagagt
gatttagcccggtcagcggcatttattatcagtgccagcgagggcggcaatcaatatctg
cccgccttgaggaaatcacctcaacgttttgaacccctatcacgggagcggttattagcc
ggagccatgctaccggcaacttggtacgtacaggcccagcgtttccgtcatcattttcgc
caacacattttgccgctgttcgagcactgggatattttgattgccccagcaacgccatgc
agtgccacgcttatcggccaggacacgatgaggattaatgatatggacctaccgatccgc
gccagtatgggcatattaacccagccaatctccttcctgggtctgccagtcgtgagcgta
cccttgaaaaccacccgcggcttaccaattggcattcagttgattgccccaccatggcga
gaagatttatgcctgcgcgcggcttatgcgctggagcaacaagggttggtcagcgcgccg
gtgagtactgttatttga

DBGET integrated database retrieval system