KEGG   Yersinia pestis A1122: A1122_14085Help
Entry
A1122_14085       CDS       T01831                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypt01100  Metabolic pathways
ypt01110  Biosynthesis of secondary metabolites
ypt01130  Biosynthesis of antibiotics
ypt01230  Biosynthesis of amino acids
ypt02024  Quorum sensing
Module
ypt_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A1122_14085
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A1122_14085
Enzymes [BR:ypt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     A1122_14085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AEL73444
LinkDB All DBs
Position
complement(3049420..3050466)
Genome map
AA seq 348 aa AA seqDB search
MYKIDELRTARIDSLITPQQLAEKLPISEVIADNVTASRKRIEKILIGEDPRLLVVIGPC
SIHDLDAAVDYATRLKVLRERYQDRLEIVMRTYFEKPRTVVGWKGLISDPALDGSCQVNL
GIELARKLLLAVNELGLPTATEFLNMVTGQYIADLISWGAIGARTTESQIHREMASALSC
PVGFKNGTDGNVRIAIDAIRAAQASHMFLSPDKTGQMTIYQTSGNPYGHIIMRGGKQPNY
DASDIAAACDSLREFDLPEHLVVDFSHGNCQKMHRRQLDVAENIGLQIRAGSTAIVGVMA
ESFLIEGTQKIVAGQPLTYGQSITDPCLNWDDTEQLLSLLADAVDSRF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagatagatgaactgcggaccgctcgcatcgatagcttgattacaccgcagcaa
ctggctgaaaagttaccgatttctgaggttattgcagataacgtgacggcgtcacgtaaa
cgaatagagaaaatacttattggtgaagacccacgtctactcgtggtgattggcccctgc
tctattcacgaccttgatgcagccgttgattatgccacccggctcaaggtgctacgagaa
cgctatcaagaccggctggaaatcgtgatgcgcacctatttcgagaaaccacggactgta
gtgggttggaaggggctgatttctgatccggcacttgacggctcatgccaggtgaacttg
ggtattgaactggcacgtaagctactgttagccgtgaatgaactcgggctgccgaccgct
accgagttcctcaatatggtaacaggccaatatattgccgacctcatcagttggggggca
ataggcgcacgtaccaccgaaagccagatccaccgagagatggcctcggcactctcctgc
cccgtgggtttcaaaaatggtacagatggcaatgtgcgtattgctattgatgccattcgc
gccgcacaagccagccatatgttcctttctccggataaaaccggccaaatgacgatttac
caaaccagtggtaacccctatgggcatattattatgcggggtggaaagcaacctaactat
gatgcctctgatatcgcagccgcctgtgacagcttgcgggaatttgatttgccagaacat
ctggtggtagattttagccacggcaattgccagaagatgcatcgccgccagttggatgtt
gccgaaaatatcgggctacagatccgtgcgggttcaacagcgattgtcggtgttatggct
gagagtttcctgattgagggcacacagaagattgttgccggacagcccttaacttatggg
caatccatcactgacccttgcctgaattgggatgatactgaacaactgttaagcctattg
gcagatgcagtagacagccggttttaa

DBGET integrated database retrieval system