KEGG   Yersinia pestis A1122: A1122_14305
Entry
A1122_14305       CDS       T01831                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ypt  Yersinia pestis A1122
Pathway
ypt00480  Glutathione metabolism
ypt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A1122_14305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypt02000]
    A1122_14305
Enzymes [BR:ypt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A1122_14305
Transporters [BR:ypt02000]
 Other transporters
  Pores ion channels [TC:1]
   A1122_14305
SSDB
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6 GST_N_5
Other DBs
NCBI-ProteinID: AEL73488
LinkDB
Structure
PDB: 
4GCI 4G9H

Position
complement(3101685..3102290)
AA seq 201 aa
MKLFYKPGACSLSPHIVLREAGLDFSIERVDLVTKKTETGADYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPNTPDE
YKTIVRERLDKQFSYVDSVLAEHDYLLGKKFSVADAYLFTVSRWANALNLQIKERSHLDQ
YMARVAERPAVKAALAAEDIK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaactgttctataaaccgggtgcttgttctctgtccccccatattgtgttgcgggaa
gcaggactagatttcagcattgaacgtgttgatttagtgacaaaaaagactgaaacgggt
gcagactatttaagcatcaaccccaaaggacaagtaccggctttagtgctggatgacggt
agcctactgactgaaggggtagctattgtgcaatatttggcagataaagtcccagaccgc
cacttgattgccccatcagggacgctctcgcgctatcatgccattgagtggctgaatttt
atcgcgactgaactacataaaggttttagcccactatttaacccaaatacaccggatgag
tataagacgattgtccgcgagcggctggataagcaattcagctacgttgatagcgtatta
gcagagcatgattatctactaggtaaaaaattcagtgtggcagatgcctacttatttacc
gttagccgttgggctaatgcgttaaatcttcaaatcaaagaacgcagccatttggatcaa
tatatggcgcgggtcgctgaacgccctgcggtaaaagcagctttagccgccgaagatatc
aagtaa

DBGET integrated database retrieval system