KEGG   Yersinia pseudotuberculosis MD67: BZ21_1719Help
Entry
BZ21_1719         CDS       T03677                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ypu  Yersinia pseudotuberculosis MD67
Pathway
ypu00020  Citrate cycle (TCA cycle)
ypu00480  Glutathione metabolism
ypu01100  Metabolic pathways
ypu01110  Biosynthesis of secondary metabolites
ypu01120  Microbial metabolism in diverse environments
ypu01130  Biosynthesis of antibiotics
ypu01200  Carbon metabolism
ypu01210  2-Oxocarboxylic acid metabolism
ypu01230  Biosynthesis of amino acids
Module
ypu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ypu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BZ21_1719 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BZ21_1719 (icd)
Enzymes [BR:ypu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BZ21_1719 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AJJ02185
UniProt: A0A2P6YDC1
LinkDB All DBs
Position
complement(1899953..1901206)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKEIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgacggtattggtgtt
gatgtaaccccggcgatgatcaacgtggtagatgctgcggttaagaaagcttataacggt
gaacgtaaaatttcctggatggaaatttacactggtgagaaatcaacccatgtctatggt
aaagatgtttggttgccagaagaaaccttagatctgatccgtgattatcgcgttgctatc
aaaggcccgttgaccactcctgtcggtggcggcatccgttctttgaacgttgctctgcgt
caacaacttgacctgtatgtgtgtctgcgtccggtgcgttattatgaaggcaccccaagc
ccggtaaaacaccctgaactgaccaacatggtgattttccgtgaaaacgctgaagatatc
tatgcgggtatcgaatggaaagcgggttcacccgaagcagagaaagtgatcaagttcctg
cgtgaagagatgggtgtgaagaaaatccgtttccctgaacaatgtggtatcggtgtgaaa
ccgtgttcagaagaagggactaagcgtttggtacgtgcagcgattgaatatgcaattacc
aacgatcgtgaatcagttacgctggttcataaaggcaacattatgaaattcaccgaaggc
gcgtttaaagactggggttatcagttagcgcgtgaggaatttggtggtgaactgatcgac
ggtggcccatgggttaaaatcaaaaacccaaataacggcaaagaaattatcgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgtcctgcggaatatgatgttatc
gcttgtatgaacctgaacggtgattacatctctgatgcattggcagctcaggttggcggt
attggtattgctccgggggctaacattggtgatgactgcgcactgttcgaagccactcac
ggtactgcaccaaaatatgctggtcaggataaagtgaacccaggttctattattctttca
gcagaaatgatgctgcgtcacatgggctggttcgaagccgctgacttaatcattaaaggc
actgaaggcgcaattcaagccaagaccgtgacttatgatttcgaacgtctgatggaaggc
gctaagttgttgaagtgtagtgagtttggcgacgccattattaagcacatgtaa

DBGET integrated database retrieval system