KEGG   Yersinia pseudotuberculosis MD67: BZ21_1961
Entry
BZ21_1961         CDS       T03677                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypu  Yersinia pseudotuberculosis MD67
Pathway
ypu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BZ21_1961
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypu02044]
    BZ21_1961
Secretion system [BR:ypu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BZ21_1961
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AJJ01200
UniProt: A0A0T9MKL1
LinkDB
Position
complement(2177322..2177807)
AA seq 161 aa
MAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHSGSGGGSGKASVSDFCFAH
YIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETR
PREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcgcaagatatgtttatcaaaattgatggtattgaaggtgagtctttggatgccaat
cacaaaaacgaaatccaggtattagcttggaactgggatgttgctcaacactcgaatatg
cacagcggttcaggtggcggttcaggtaaagcctctgtttcagatttttgcttcgcacat
tatatcgataaagctagcccgaacttattgagctattgcttgctgggtaagcacattaaa
aatgttcagttcgtactgcgtaaagccggtggcgatccgctggaatatctgacaattaaa
tttaccgatgtcatcattactcgtgttgatatggcgggttctttggaagatgaaacgcgt
ccacgtgaagaaattcgtttctcattcactaagatgactcaggactatgttatgcagaat
gctgaaggccataaatctggcgttatttctgctaactacgatgttaaagctaacatgcac
agctaa

DBGET integrated database retrieval system