KEGG   Yersinia pseudotuberculosis MD67: BZ21_1962
Entry
BZ21_1962         CDS       T03677                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ypu  Yersinia pseudotuberculosis MD67
Brite
KEGG Orthology (KO) [BR:ypu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypu02044]
    BZ21_1962
Secretion system [BR:ypu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BZ21_1962
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AJJ01756
UniProt: A0A0T9JCU8
LinkDB
Position
complement(2178140..2179642)
AA seq 500 aa
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVS
DDAYKSIASIIAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLD
ISKDELRRNMKRYKGVAWDQSPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLA
SIGKVAASAHVPFITGAAPSVLQMESWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRY
IGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVWSNAAYAMAVNINRSFKEYGW
CTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNT
DYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQL
EGLTVSLRMVAKLPSLKDVA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtccactcaagacgcaaaaactaaacaagctacagtcgccagtgcgacggaatatagc
gattttaatacattactgactaaagaatttaaagcgaagtctgagcagacgatagcagca
gtagaaggtgccgttaaaacgttggctgagcaagcgctggctaattcggtcacggtgtca
gacgatgcttataaaagcattgcttccattattgcagagattgatcgcaagctatcagat
cagattaatttaattttgcaccaccaagaattccagtctctggaaagcgcatggcgtggg
ctacactatttagtcaataacaccgagactgatgagaagttgagattacgtttcctcgac
atctctaaagatgaattacgccgtaacatgaagcgttataaaggtgttgcttgggatcaa
agcccattattcaaaaaaatctatgaagaagaatatggccaactgggtggcgaaccatac
ggttgcctggtagcagactattactttgaccatactgcacctgacgttgacttgttggct
tcaattggcaaagttgccgcgtctgcccacgtgccatttattacaggtgctgcaccgtct
gtgttgcaaatggaatcttggcaagaactgtcaaacccacgtgatttgacgaagatcttc
actcagaatcttgagtatgccgcatggaactcactgcgtcagtctgaagactctcgctat
atcggcctggcgatgccacgtttcttgtcgcgtctgccttatgggattaataccaacccg
gtagatgccttccattttgaagagacgacggatggcgcggatcacagcaaatatgtgtgg
tcaaatgcggcttatgcgatggctgttaacatcaaccgatctttcaaagagtatggctgg
tgtacgctgattcgtggggtggaaagtggtggtgttgttgaaggcctgccatgccatacc
ttcccgacggatgacggcggtattgatatgaaatgcccaacagaaatcgctatttctgac
cgtcgtgaagcggaactggccaagaatggttttattccactggttcacagaaagaatact
gattacgcggcattcattggcgcgcagtccctgcaaaaacctgcagaatattacgattcg
gatgcaacggcgaacgccaacctttccgctcgtctgccatacctgtttgcttgttcacgt
tttgcacattatctgaagtgcatcgtgcgtgacaaaatcggctctttcaaagagcgtgat
gagatgcaacgttggttgaatgactgggtgatgaactatgttgatggtgacccggctaac
tcttctctggaaactaaagcgcgccgtcctttagccgctgctgaagtgattgttgaagaa
gttgaaggtaaccctggttactatcaggctaaattcttcttacgccctcatttccagtta
gaaggtttgacagtctccctgcgtatggttgctaaactgccttcgctgaaagacgtagca
taa

DBGET integrated database retrieval system