KEGG   Yersinia pseudotuberculosis MD67: BZ21_2305Help
Entry
BZ21_2305         CDS       T03677                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ypu  Yersinia pseudotuberculosis MD67
Pathway
ypu00061  Fatty acid biosynthesis
ypu00780  Biotin metabolism
ypu01100  Metabolic pathways
ypu01212  Fatty acid metabolism
Module
ypu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ypu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BZ21_2305 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BZ21_2305 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ypu01004]
    BZ21_2305 (fabZ)
Enzymes [BR:ypu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BZ21_2305 (fabZ)
Lipid biosynthesis proteins [BR:ypu01004]
 Fatty acid synthase
  Component type
   BZ21_2305 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT_3 PS-DH 4HBT
Motif
Other DBs
NCBI-ProteinID: AJJ02384
UniProt: A0A3G5KCD4
LinkDB All DBs
Position
complement(2556794..2557324)
Genome map
AA seq 176 aa AA seqDB search
MTTDTHTLHIEEILDLLPHRFPFLLVDRVLDFEEGKFLRAVKNVSFNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSRGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVEFVKE
RRGLTRFTGVAKVDGEIVCTATMMCARSKPAAPAESVVVKPDVVKPDVVNPVVKES
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcatattgaagagattttggatctactcccgcaccgt
tttccgttcttgctggtagaccgtgtccttgattttgaggaaggaaaatttctgcgtgca
gtgaagaacgtctcttttaacgagccatttttccaaggccatttcccaggcaagcccatc
ttccctggtgtgcttatattagaagcgatggcgcaggctacagggattttggcgtttaag
agccgcggtaaactggaaccgggcgagctttattactttgctggtattgatgaagcacgt
tttaagcgcccagtagtgcctggcgatcagatgatcatggaagttgagtttgttaaagaa
cgccgtggcctaacccgttttaccggtgtagctaaagtcgatggcgaaatcgtttgcact
gccaccatgatgtgcgcgcgtagcaaaccagcagcacctgcagaatctgtcgttgtaaaa
ccagatgttgtaaaaccagatgttgtaaatcctgtcgttaaggagtcctga

DBGET integrated database retrieval system